SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000056756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000056756
Domain Number 1 Region: 3-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-73
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1472-1687
Classification Level Classification E-value
Superfamily Plakin repeat 3.53e-44
Family Plakin repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 1692-1877
Classification Level Classification E-value
Superfamily Plakin repeat 1.19e-39
Family Plakin repeat 0.00075
Further Details:      
 
Domain Number 4 Region: 6505-6661
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 6110-6228
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 216-332
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 6285-6444
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-26
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 5957-6116
Classification Level Classification E-value
Superfamily Spectrin repeat 4.26e-24
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 9 Region: 5194-5350
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-24
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 5626-5785
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-23
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 4424-4585
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-23
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 12 Region: 5302-5459
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-22
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 13 Region: 6656-6772
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-22
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 14 Region: 4756-4911
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 7019-7101
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.57e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 16 Region: 3975-4110
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 6722-6848,6879-6910
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 18 Region: 4970-5129
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-16
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 19 Region: 6930-7010
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000001
Family Polcalcin 0.044
Further Details:      
 
Domain Number 20 Region: 650-752
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 21 Region: 5420-5566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000173
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 22 Region: 1184-1312,1339-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000834
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 23 Region: 3719-3842
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000252
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 24 Region: 4558-4695
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000157
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 25 Region: 3893-4006
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 26 Region: 4173-4295
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000274
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 5783-5896
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000504
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 28 Region: 4332-4443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000468
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 29 Region: 557-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000995
Family Spectrin repeat 0.0045
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000056756
Domain Number - Region: 732-831
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000273
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 978-1119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000734
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 3239-3347
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00106
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 3487-3601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00114
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1383-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.082
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000056756
Sequence length 7327
Comment (Rattus norvegicus)
Sequence
VRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLV
NIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGV
RCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPE
DVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHV
VTMSERTFPNNPLELKALYNQYLQFKEKEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQ
GYHPNDIEKEWGKLIIAMLEREKALRPEVERLDMLQQIATRVQRDSVSCEDKLMLARNAL
QSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILLDGKYYQAEQLVQRVAKLRD
EILALRNECSAVYSKGRMLTTEQTKLMISGITQSLNSGFAQTLHPSLNSGLTQSLTPSLT
SSSVTSGLSSGMTSRLTPSVTPAYTPGFPSVVAPNFSVGVEPNSLQTLKLMQIRKPLLKS
SLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEF
ESSLKEAKISEIQMTAPLKLSYTDKLHRLESQYAKLLNTSRNQERHLDTLHNFVTRATNE
LIWLNEKEESEVAYDWSERNSNVARKKGYHAELMRELEQKEESIKAVQEIAEQLLLESHP
ARLTIEAYKAAMQTQWSWILQLCQCVEQHIQENTAYFEFFNDAKEATDYLRNLKDAIQRK
YVCDRSSSIRKLEDLVQESMEKEELLQYRSVVAGLMGRAKTVVQLKPRNPDNPLKTSIPI
KAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDFA
NRIEQQYQSVLTLWHESHVNMKSIVSWHYLVNEIDRIRASNVASIKTMLPGEHQQVLSNL
QSRLEDFLEDSQESQIFSGSDITQLEKEVNVCRKYYQELLKSAEREEQEESVYNLYVSEV
RNIRLRLESCEDRLIRQIRTPLERDDLHESMLRITEQEKLKKELERLKDDLEAITNKCEE
FFSQAADSPSVPALRSELSVVLQSMSQIYSMSATYVEKLKTVNLVLKNTQAAEALVKLYE
TKLCEEEAVIADKNNIENLMSTLKQWRSEVDEKREVFHALEDELQKAKAISDEMFKTHKE
RDLDFDWHKEKADQLVERWQSVHVQIDNRLRDLEGIGKSLKHYRDSYHPLDDWIQQIETT
QRKIQENQPENSKALAVQLNQQKMLVSEIEVKQSKMDECQKYSEQYSAAVKDYELQTMTY
RAMVDSQQKSPMKRRRIQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEE
KSLDEEKKQHVEKAKELQKWVSNISETLGDGERAGKPHFSKQQISSKEISAKKEQFSEAL
QNTQIFLAKHGDKLTEEDRSDLEKQVKTLQEGYNLLFSESLKQQELQPSGEAKVKVEPDK
VIAGTINQTTGEVLSVFQAVLRGLIDYETGIRLLEAQLVISGLISPELRKCFDLKDAERH
GLVDEQILGQLKELNEAKQIISTASPTMIPVLDSLDRGVISESVAIRVLEILLSTDSLVV
PATGEHLTLQKAFQQNLISSALFSKVLERQAACKDLIDPCTSEKVSLTDMVQRSILQENT
RMWLLPVRPQEAGRITLKCGRSVSILRAAHEGIIDRETMFRLLGAQLLSGGLVDCNSGQK
MTVEEALAEGVIDRDTASSILTYQVRTGGILHSNPAKRLTVDEAVQCELITSSSALLVLE
AQRGYVGLIWPHSGEIFPTASSLEQELITNELACKILNGRQKIAALYFPETSQVIDLDAA
RRLGIIDNNTASVLKHVTLPDKMPDLGDLEACKNARKWLSFCKFQPSTAHHYTQEEDGSD
GDEPVAAQSSEQTKKLFLSYLMVNSYMDANTGRRLLLHDGDLEEAVGMLLESCGAELGAG
TAVRESLSVLPVPDASPDCASSREKHGCSTDKCHYRHPGHKGPLENAKWDLNGELCEMGN
NEDSGELPRLENLTDTTVAQKAGGPSSVRVPKPTSYSTQPELKNQSELDTEASPDEGIHS
GVCTSETSRLCDASETEDEDHIQKGPSVFDYSPRLSALLSHDLLRHSQGSFSDTPKNTGY
LCEASTLSSGDQSVLADQSTGEKLQDQFLGIAAISVSLQGAPCGQTPVDNGCSNCQVHYS
SDEYMSDASAESGTTRQTSETEKTGSEVEDDSCTMIPGDGSCNANPSACRPLSLKGAIDA
GDYETSLLAGQQSDTATDSDSDDYFYDTPLFEDEDHDSLILQGDDHDCLQPEDYDTLQEE
NDKTPPPDDIFYDVLKENENPESSPGGMDESLSAGGKVHFPQGFLVGTKRPELYVVDQKQ
FNLGDSDKLAEPVPESETPSDLEHSESDSLTDGEITGRKESLGTSVTPGGRWRGDREECD
TSQESQSDTDGVGFVQSIESSRLYMSDGSDRDEEDNGTYSSEDDDDRGGGGQEVAGENGE
PSDPASHNQLYTATVKESGAETQSVRDTILLDRMHGYSPLEKQQRGRVLQPESAGKRGRD
TERSNHPELTTEADEEDRASVSTHMATTGVSLSNAQGTASENVELVQGPGSTDILKDEDE
YLENGSPKNGQPSNKIVCSEAGLGGGPSEESHLSFTVSNRGQRGTGRGQVKGRDGKNSQG
VGEMSIQETGFREDGGLMSSPEEGEEERCLNPFPNGIATGSPNTGESLFTPLLTHTEELR
HRGDPNTATMTLDCEAKDGQTGLRESPVLLETLAEIFDTSASKETHADPTSALRSSGVKS
QVKEDSLTGGSEKETGPFTSPERCDKCVNVDVLESNKHTPSCAFIASPPMKDDLPTVTNA
EEKPVIPQGDWPSGAKIQPSGACVKGSMSEGKAGIPHFTPEHSDTTLSLLPQKSVAECGG
NTDFVQAQLHMNGVRNTSDNTLDVGCPRLESSREKERTEKQPHGERTSSPRPQERVHTPE
FGEDGGTLKSGLDKVQMNLQDVGDPSACTGTTISIQNLIKRAILSELPNETSNVPSPGVS
PINNSSEEKAENRGDPLCIASLLEILKQDQHTQETPGTSELIKVLTQTACNPEERGLVSG
LFPPQLKNVFCKLLLDGYSAEREQAEALKQTPGAAPEMVEEKPCDCSDLKSKEGNHYTPN
PQTVREAGVEHSGVHTAALPRDEEFGELCSEPPDHSECTSGSKEISSDDNTKEKCSNGLQ
QCLQHTEKMHEYLALLQDMKPPLDNQAAMENSLEALKNQLKQLETFELGLAPMAVFLRKD
LKLAEEFLKSFPSDLPGRHHEELSKSHERLQNAFESLSSVSSQRMKLITLAIDTETSKLA
VRHEDFLHRLTSYSDWVSEKSRSVADIQTVNVQDTELVKNSVKFLKNVLTDLSHTKVQLE
TTAFDIQSFISDYAQDLSPNQSRQLLRLLNTTQKCFLDVQELVTSEVVRLETLLQLEQEL
GHQKVVAERQQEYKEKLQGLCDLLTQTENRLISHQETFVIGDGTVELKKYQSKQEELQRD
MQGSTQALAEIVRNTEIFLKESGDELSQEDKALIEQKLNEAKVKCEQLNLKAEQSTKELD
KVVTAALKEETEKVAAARQLEESKTKIENLLNWLSNVEKDSEGSGRLHTQPLEQNGTHLH
EGDGTSEAGEEDEVNGNLLETDAEGHGGMTEGNLNQQYEKVKAQHEKIVAQHQAVIMATQ
SAQALLEKQGHHLSPEEKEKLQANVQELKAHYETVLAECEKKVKLTHSLQEELEKFDADC
GEFEHWLQQSEQELENLEAGADDLSGLTDKLARQKSFSEDVISHKGDLRYITISGNRVME
AAKSCSKRDGDRIGKDSLETSATHREVQTKLDQVTDRFRCLYSKCSVLGNNLKDLVDKYQ
HYEDASCGLLSGLQACEAKASRHLLEPIALDPKNLQRQLEETKALQGQISSQQAAVEKLK
KTAEVLLDAKGSLLPAKNDIQKTLDDIVGRYDDLSKSVNERNEKLQITLTRSLSVQDGLD
EMLDWMGSVESSLVKQGQVPLNSTALQDLISKNIMLDQDITGRQSSINAMNEKVKTFIET
TDPSTASSLQAKMKDLSARFSEASQKHKEKLAKMVELKSKVEEFEKLSDKLQTFLETQSQ
ALTEVDMPGKDVPELSQHMQESTTKFLEHRKDLEALHSLLKEISSHGLPGDKALVFEKTN
NLSKKFKELEDTIQEKKEALSSCQEQLSAFHDLAQSLKTWIKETTKQVPIVKPSFGTEDL
EKSLEETKKLQEKWSLKTPEIHKANNSGVSLCNLLSALISPAKAIAAARSGGVILNGEGT
DTNTQDFLANKGLTSIKTDMTDISHSYEDLGLLLKDKIVELNTKLSKLQKAQEESSAMMQ
WLQKMNKTASRWRQTPTPADSESVKIQVEQNKSFEAELKQNVNKVQELKDKLAELLKENP
EAPEAPSWKQTMAEMDTKWQELNQLTIDRQQKLEESSNNLSQFQTTEAQLKQWLVEKELM
VSVLGPLSTDPNMLNTQKQQAQILLQEFDTRKPQYEQLTAAGQGILSRPGEDPSLHGIVK
EQLAAVTQKWDNLTGQLRDRCDWIDQAIVKSTQYQSLLRSLSGTLTELDEKLSSSLISGT
LPDAVNQQLEAAQKLKQEIEQQTPKIKEAQTLCEDLSALVKEEYLRAELSRQLEGVLKSF
KDIEQKTENHVQHLQSACASSHQFQQMSKDFQAWLDAKKEEQRNSPPISAKLDVLESLLK
AQKDFGKTFTEQSNIYEKTVAEGENLLSKTQGAEKAALQLQLNTIKTDWDRFRKQVKERE
EKLKESLEKALRYREQVDTLQPWVDKCQHSLESVKLSLDPADTERSITELKTLQKEMDHH
FGTLELLNNSANSLLSVCEVDKEVVTEGNKSLIQKVNVVTEQLQSKKVSLENMAQKFKEF
QEVSKDAKRQLQDTKEQLEVYQSLGPQACSNKHLTMLQAQQKSLQTLKHQVDSARRLAQD
LVMEATDPKGTSDVLSQAETLAEEHRGLSQQVDEKCSFLETKLQGLGHFQNTIREMFSQF
TEFDDELDSMAPVGRDVETLQKQKASMQTFLKKLEALITSNDSANRTCKMMLATEETSPD
LIGVKRDLEALSKQCNKLLDRAKTREEQVSGATEKLEEFHRKLEEFSTLLQKAEEHEESQ
GPVGTETDAINQQLDVFKIFQKEEIEPLQAKQQDVNWLGQGLIQSAAANTCTQGLEHDLD
SINARWKTLNKKVAQRTSQLQEALLHCGRFQDALESLLSWMADTEELVANQKPPSAEFKV
VKAQIQEQKLLQRLLEDRKSTVEAIKREGEKIAASAEPADRVKLSRQLSLLDSRWEMLLS
RAEARNRQLEGISVVAQEFHETLEPLNEWLTAVEKKLANSEPIGTQAPKLEEQIAQHKAL
QEDILLRKQSVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEH
ALQLAGQLQSKHKELCNWLDRVEVELLSYETQGLKGEAASQVQERQKELKNEVRNNKALL
DSLNEVSSALLEVPWRAREGLEKTVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAA
DAELSWITETQKKLMSLGCIRLEQDQTSAQLQAQKAFTMDILRHKDIIDELVTSGHKIMT
TSSEEEKQSMKKKLDKVLKKYDAICQINSERHLQLERAQSLVSQFWETYEELWPWLMETQ
QIISQLPAPALEYETLRRQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPKEGVHIQE
KYVAADTLYSQIKEDVKKRAVVLDEAISQSTQFHDKIDQILESLERIAERLRQPPSISAE
VEKIKEQIGENKSVSVDMEKLQPLYETLRQRGEEMIARSEGTEKDISAKAVQDKLDQMVF
IWGSIHTLVEDREAKLLDVMELAEKFWCDHMSLVVTTKDTQDFIRDLEDPGIDPSVVKQQ
QEAAEAIREEIDGLQEELDMVITLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKD
RIDRLGEAMQAAVQYQDGLQAIFDWVDIAGNKLATMSPIGTDLETVKQQIEELKQFKSEA
YQQQIEMERLNHQAELLLKKVTEEVDKHTVQDPLMELKLIWDSLDERIVSRQHKLEGALL
ALGQFQHALDELLAWLTHTKGLLSEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAV
NKAGNDLIESSEGEEASNLQYKLRILNQRWQDILEKTDQRKQQLDSALRQAKGFHGEIED
LQQWLTDTERHLLASKPLGGLPETAREQLNAHMEVCTAFAIKEETYKNLMLRGQQMLARC
PRSVETNIDQDITNLKEKWESVKSKLNEKKTKLEEALHLAMEFHNSLQDFINWLTQAEQT
LNVASRPSLILDTILFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFSQKQDVVLIKNL
LISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEAWSKLMEWLEDSEKSLDSELEIANDP
DKIKAQLVQHKEFQKSLGGKHSVYDTTNRTGRSLKEKTSLADDTLKLENMLSELRDKWDT
ICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGDIDLVMNLIDNH
KVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVRVQMQELSTRWETVCALSISKQTRL
ESALQQAEEFHSVVHTLLEWLAEAEQTLRFHGALPDDEDALRTLIEQHKEFMKKLEEKRA
ELNKATGMGDALLTACHPDSITTIKHWITIIQARFEEVLAWAKQHQQRLAGALAGLIAKQ
ELLENLLAWLQWAETTLTEKDKEVIPQEIEEVKTLIAEHQTFMEEMTRKQPDVDKVTKTY
KRRAADPPSLQSHIPVLDKGRAGRKRFPASGLYPSGSQTQIETKNPRANLLVSKWQQVWL
LALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKI
TRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADK
IEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGW
MALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRST
SASSHACQAASPQVPAAASTPKILHPLTRNYGKPWLANSKMSTPCKAAECPDFPVSSAEG
TPIQGSKLRLPGYLSGKGFHSGEDNALITTAASRVRTQFAESRKTPSRPGSRAGSKAGSR
ASSRRGSDASDFDISEIQSVCSDVETVPQTHRPAPRAGSRPSTAKPSKIPTPQRKSPASK
LDKSSKR
Download sequence
Identical sequences 10116.ENSRNOP00000056756 ENSRNOP00000046024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]