SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > STRING v9.0.5 > 10116.ENSRNOP00000056859

Domain assignment for 10116.ENSRNOP00000056859 from STRING v9.0.5

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  10116.ENSRNOP00000056859
Domain Number 1 Region: 1173-1235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.1e-20
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 144-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1115-1177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000688
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1047-1109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000996
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 929-991
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000105
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 7 Region: 627-683
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000315
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 687-743
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000944
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 9 Region: 808-863
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000354
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 869-940
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000485
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 11 Region: 988-1050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 12 Region: 205-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000157
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 13 Region: 21-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000629
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 14 Region: 262-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000904
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 15 Region: 396-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 16 Region: 508-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000175
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 17 Region: 562-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 18 Region: 455-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000341
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000056859
Domain Number - Region: 324-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00057
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number - Region: 751-802
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000796
Family Complement control module/SCR domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000056859
Sequence length 1235
Comment (Rattus norvegicus)
Sequence 
MRLSARIIWLILWTVCVAEDCKGPPPRENSEILSGSWSEQLYSEGTQATYKCRPGYRTLG
TIVKVCKNGEWVPSNPSRICRKRPCGHPGDTPFGSFRLAVGSEFEFGAKVVYTCDEGYQL
LGEIDYRECDADGWTNDIPICEVVKCLPVTELENGRIVSGAAEPDQEYYFGQVVRFECNS
GFKIEGQKEMHCSENGLWSNEKPQCVEISCLPPRVENGDGIYLKPVYKENERFQYKCKQG
FVYKERGDAVCTGSGWNPQPSCEEMTCLTPYIPNGIYTPHRIKHRIDDEIRYECKNGFYP
ATRSPVSKCTITGWIPAPRCSLKPCDFPQFKHGRLYYEESRRPYFPVPIGKEYSYYCDNG
FTTPSQSYWDYLRCTVNGWEPEVPCLRQCIFHYVEYGESLYWQRRYIEGQSAKVQCHSGY
SLPNGQDTILCTENGWSPPPKCVRIKTCSVSDIEIENGFFSESDYTYALNRKTRYRCKQG
YVTNTGEISGIITCLQDGWSPRPSCIKSCDMPVFENAMTKNNNTWFKLNDKLDYECHIGY
ENEYKHTKGSITCTYDGWSSTPSCYERECSIPLLHQDLVVFPREVKYKVGDSLSFSCRSG
HRVGADLVQCYHFGWSPNFPTCEGQVKSCDQPLEIPNGEIKGTKKVEYSHGDVVEYDCKP
RFLLKGPNKIQCVDGKWTTLPICVEYERTCGDLPALEHGSVQLSVPPYHHGDSVEFTCAE
TFTMIGHAVVFCISGRWTELPQCVATDQLEKCKAPKSTGIDAIHPNKNEFNHNFSVSYRC
RQKQEYEHSICINGRWDPEPNCTRNEKRFCPPPPQIPNAQVIETTVKYLDGEKVSVLCQD
GYLTQGPEEMVCKHGRWQSLPRCTEKIPCSQPPKIEHGSIKSPRSSEERDLIESSSYEHG
TTFSYVCDDGFRISEENRVTCNMGKWSSLPRCVGIPCGPPPSIPLGIVSHELESYQYGEE
VTYNCSEGFGIDGPAFIKCVGGQWSEPPKCIKTDCDNLPTFEIAKPTEKKKKSYRSGEQV
TFRCPPPYRMDGSDIVTCVNTKWIGQPVCKDNSCVNPPHVPNATILTRHKTKYPSGDKVR
YDCNKPFELFGEVEVMCQNGIWTEPPKCKDSTGKCGPPPPIDNGDITSLSLPVYAPLSSV
EYQCQNYYLLKGNKIVTCRNGKWSQPPTCLHACVIPEDIMEKHNIVLRWRENAKIYSQSG
ENIEFMCKPGYRKFRGSPPFRTKCIEGHINYPTCV
Download sequence
Identical sequences G3V9R2
NP_569093.2.100692 NP_569093.2.4139 ENSRNOP00000017749 10116.ENSRNOP00000056859 ENSRNOP00000056859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.