SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000057160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000057160
Domain Number 1 Region: 27-111
Classification Level Classification E-value
Superfamily Immunoglobulin 2.86e-23
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000057160
Sequence length 112
Comment (Rattus norvegicus)
Sequence
MHRFLGVSMVTLWLQLTRMNSQVAGENPWALRIHEGENVTVNCSYKTSLTVLQWYRQKLD
QGPALLVFIRSNEREKHSGRLRATLDTSSQSSSLSITAAQSADTAVYFCATD
Download sequence
Identical sequences ENSRNOP00000057160 10116.ENSRNOP00000057160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]