SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000057199 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000057199
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000104
Family Snake venom toxins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000057199
Sequence length 102
Comment (Rattus norvegicus)
Sequence
MNSMTKISILLIVALSFLCFTEANTNLICNTCNRSENSECKNGTGQCTAPEGGSCSTISI
YHGQRHVLSKQMCLGHCEEKPHYNGDFMIYVMCCSKNLCNSF
Download sequence
Identical sequences D4AE27
10116.ENSRNOP00000057199 ENSRNOP00000057199 ENSRNOP00000057199 NP_001102227.1.100692 NP_001102227.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]