SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000057404 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000057404
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-25
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 2 Region: 157-332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-25
Family Laminin G-like module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000057404
Sequence length 1345
Comment (Rattus norvegicus)
Sequence
MAEVSPELSLQFRFQTSKPQGLLFLAAGKTDYCLIELLSGTLQVKVKVGTGKQILLSEQR
LRVDDLVWHSVGLQCGKDHVSLVIDKHHETTGQLAGGMRNFTFHHGIYVGGRGGLSVPYL
DRKTPNFRGCMEDVVFNQREILTSLRSYPGFKKVNEVSLGCSDEFFAGKDEAISFFSSRS
YVTFPEWKVYHGEGILRFAVQTETPQALLLFQSGRGRDFVALEIHEGQLKAHVGRGGTKT
QLSSFSLVSDNKWHIVQLRVAGRHVDLMVDEHGERAGLPLQSQEFMSEGPLFVGGLNDRM
WETAHSLELVSVPGKSIRGLSLKGCLQALEANLEKRALRDALVSRDVSAGCTSEGLRGTD
PPVAGEDVLPPQPSPSTAAPNASSPLKNRSGRFLVLNKLEVQEGGRALLGQRHIEVGVDF
MYLGINYSQILFNIQEMPMHGFLQIDVWPAQEMEQTFTLSDLRRGKVWYVHDGSEEPTDC
FTFRVSSNSKKVVLSQLQDLVAHVFNIVVLPVNDPPYLRLPEGHLLLFENTKQRLTPGLM
QVLDPDTDAQHLRFSVLNTFSSEAGFLESAKDPGKAISDFTDADLQDGNIFYVHRGHQNS
RIVLRATDGELVSNTVVLRVMAVPWDFEVADRTGVVVPQGGTVLITGSNLSVKVNGGQHE
LDTRYDITHPPQFGQIQHLGSNGEWEPVRTFSQRSVDRGEIRYYSSFKELQQENVTDHFK
FKVSIEGRVSKELLFPVTVEWLQLTLPKNIPLEISNINRKVLDSGHLQAAAGSVQVAERE
LFFKLLMPPKKGKLLLGDEVLKSGSMFSQKNVTDSMVSYKPQGRPWEHSQDSFSFSIVVK
QVESKGHTFRINLEVDKTHITVTNTGLYVKEGEWTIITKSEFFVQTLDHRIFQYKVTKSP
QHGELKLVSSSTSPGSESRATGFTDDDIVSERLIYAHDDSETRWDEFVILASATGLGQQG
GVRSPDSEHVSTEIKVSISVELKNDEKPVRVVDKIFHVVRDSQRLLTLADLCYHDPDVDF
DDGQLLYTRHGIPNGDLVKATDPTQKLYQFRQEDLREGRVLFKHNGPDSARFLLFVTDGV
HYTSSLLEVSVSEAYIHIINNTGLLVHRGRDGFLTTANLSVTTNQDVRTDHEFEFHVVQP
PKHGRLLVNNSAFHSFSQHDLKQGHVTYRYNGDGNSDIFNLTVTVKDTSLDVSVCVQVSS
EDHQHYSPILHRESLTVEGKPVKLSRGKLQAGNEEDIPSEAVFIVRTLPVHGYPQKSTAE
GSIMGADGKPTLSFTRQDIDDGNVLYVQTTPGQQRDQFILDVTKDSQVVRRVEMLLDLIP
KWMPLEVQNLTVQAGGSKALLQDHL
Download sequence
Identical sequences D4AE71
NP_001127982.1.100692 NP_001127982.1.4139 ENSRNOP00000057404 10116.ENSRNOP00000057404 ENSRNOP00000057404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]