SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000058275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000058275
Domain Number 1 Region: 331-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-36
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.01e-20
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 3 Region: 90-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000733
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000058275
Domain Number - Region: 241-299
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0785
Family Aspartate receptor, ligand-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000058275
Sequence length 508
Comment (Rattus norvegicus)
Sequence
MADPKMASQLQEDVTCPICLEILQDPVTIDCGHNFCLKCINQIGKTSENILCPLCKCSVS
KNTFRPNKLLASLAEKIQTMDPADIQQEKEEARCQKHKKKLYYFCEQDGALLCVVCRDSK
DHKFHDVTLIDEAVQNYKVQIESQAQDLGRKDKEIIEEKKRGEGAIWTFRAQVELEKLKV
IEEFKHLRQRLDEEESFLLSRMDWLEKQGAKQLGQYVTVTEKQLNSLRTLTKSLKIRLQS
SSIELLKDAEDTLQQRNKEFQFLSPIPVPVDLEKKRSEAKARLESVLKSLTEFKDNLKAK
GKKDKSEFVSSLNKEERESWSLLQKNNSMSPTPVPMTLDKDSADPDLTISHDGKKVTLYY
IAGKASNKQAKPRPFYPFHCVRGSPGLSSGRRVWEAEIWEPSGGACIIGVATELAQGSQS
QNIRMQNCIWALRISPTGCQPFTNCKTQEHLQVCLKKVGVYVNHDCGEVIFYDAITSKHI
YTFQTSFNGRVFPLFGLQVTCSHITLTP
Download sequence
Identical sequences ENSRNOP00000058275 10116.ENSRNOP00000058275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]