SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000058975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000058975
Domain Number - Region: 85-129
Classification Level Classification E-value
Superfamily POZ domain 0.00942
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000058975
Sequence length 215
Comment (Rattus norvegicus)
Sequence
MTSLSSDLEHVSLPIQKDNLESPVPARRTSSRSPSSDEDPGLLSFSLAERNPPSPLVSGN
LPFPASAPEKGKKQDDSEDSAEPEMLCSVEHPCQFFAEAQRLREQKLLLDEEVTVRGQVY
GVHRAALTFAYEGVLGPAPQDEVLAAAKALGAPRVKIAAQLRPEGLGKAREDEKKLTQAE
ELRENLHSIERLYREGIGCDLELEAEGYRLQGEGL
Download sequence
Identical sequences 10116.ENSRNOP00000058975 ENSRNOP00000058975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]