SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000059146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000059146
Domain Number 1 Region: 28-94
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000729
Family Eukaryotic type KH-domain (KH-domain type I) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000059146
Sequence length 139
Comment (Rattus norvegicus)
Sequence
SRGISETEMDAANENSWWMIPENFESPFVFFIDEDQEQHIFGHGDEYLRCVEEHSNTFIQ
LERWFTASGQTRVTVVGPFRSKHWLVDMIWNLCNQEACHRARGQEMLDLVRKQPLTRAHL
DASLTVQARDIKDLVTTWD
Download sequence
Identical sequences A0A0G2K8J7
10116.ENSRNOP00000059146 ENSRNOP00000059146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]