SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000060173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000060173
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily TPR-like 4.36e-35
Family Tetratricopeptide repeat (TPR) 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000060173
Sequence length 179
Comment (Rattus norvegicus)
Sequence
MPRDEAARNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSK
EEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKGDRPHAV
CSSSSLRPGPWEHCPHPLHTHSPLSNLPSKGLGSPGAPTLRLYIQVPLFCGGECGQGRG
Download sequence
Identical sequences 10116.ENSRNOP00000060173 ENSRNOP00000060173 ENSRNOP00000061895 XP_006249184.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]