SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000061027 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000061027
Domain Number 1 Region: 658-684,719-872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-37
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00045
Further Details:      
 
Domain Number 3 Region: 272-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-30
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 4 Region: 903-1107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-29
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 88-273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-20
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 6 Region: 513-571
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000133
Family Fibrinogen C-terminal domain-like 0.0041
Further Details:      
 
Domain Number 7 Region: 485-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000061027
Sequence length 1242
Comment (Rattus norvegicus)
Sequence
GAGGWSPLVSNKYQWLQIDLGERMEVTSVATQGGYGSSNWVTSYLLMFSDSGRNWKQYRQ
EDSIWGFSGNANADSVVYYRLQPSIKARFLRFIPLEWNPKGRIAMRIEVFGCAYRSVVID
LDGKSSLLYRFDQNSLSPIRDIISLKFKTMESDGILLHRAGPGGDHITLELRRGKLFLLI
HSGKTTCTSCVDHINLLTSDLNMQIAMSTLLNSPSSSVNREVHFSSLSNKYQNQVQYLNF
FLCISFGGISAPAKSVSLPYKYFRGCLENLFYNGVDVIGLAKQHSPQIITMGNTSFSCSQ
PQSMPLTFLSTRSYLVLPASSKEEAISVSFQFRTWNKAGLLLFRKLWLMKGTLLIHLRDR
KVKRGSDFLGKAIHDLLACAGLDDGQWHSVSLSAKRNHLTVVVDGHISPASPWLGPEQVN
SGGIFYFGGCPDKSFGSRCKSPLGGFQGCMRLISIQDKMVDLLAVQQGSLGNFSDLQIDS
CGISDRCLPNSCEHGGECSQSWSTFHCNCTNTGYTGATCHSSVYEQSCEAYKHRGNASGF
YYIDSDGSGPLRPFLLYCNMTETAWTVIHHNGSDLMRVRNAHSENVHTGVFEYVASMGQL
QASINRAEHCQQELVYYCKKSRLVNQQDGSPRSWWVGRTNETQTYWGGSLPMPQKCTCGL
EGNCIDAQYHCNCDADRNEWTNDTGFLSYKEHLPVTKIVITDTGRPHSEAAYKLGPLLCR
GDRPFWNAASFNTEASYLHFPTFHGELSADVSFYFKTTALSGVFLENLGITDFIRIELRS
PTTVTFSFDVGNGPFELSVHSPTHFNDNQWHHVRVERNTKEASLQVDELPPKIQAAPTDG
HVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMALDLEERATVTPGVQPGCRGHCGSYG
KLCRHGGKCREKPSGFFCDCSSSAYAGPFCSKEISAYFGSGSSVIYNFQENYSLSKNSSF
HAASFHGDMKLGRETVKFNFRTTRAPSLLLYMSSFYKEYLSVIIAKNGDLQIRYRLNKYH
EPDVISFDLKSMADGQLHHLKISREEGMVFVEIDENTRRQTYLSSGTEFSAVKSLVLGRM
LEYSDVDQETALAAAHGFTGCLSAVQFSHIAPLKAALQPGRPAPVTVTGHVTESSCVAPA
GTDATSRERTHSFADHSGTMDDREPLTHAIKSDSAVIGGLIAVVIFILLCVSAIAVRIYQ
QKRLYKRNEAKRSENVDSAEAVLKSELHTQNAVGENQKEYFF
Download sequence
Identical sequences 10116.ENSRNOP00000061027 ENSRNOP00000015337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]