SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000061306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000061306
Domain Number 1 Region: 251-334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-21
Family SPRY domain 0.00062
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000984
Family RING finger domain, C3HC4 0.0063
Further Details:      
 
Domain Number 3 Region: 68-127
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000565
Family B-box zinc-binding domain 0.0035
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000061306
Domain Number - Region: 206-263
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0294
Family CRAL/TRIO domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000061306
Sequence length 335
Comment (Rattus norvegicus)
Sequence
ETRCSICLDDRTKPVTIKCEHNFCQCIKDCWAKHPAMFSCPVCQHQCQHRTLRSNAQLLQ
EKSKMQEPSTSCEKHNQFFSVFCEDDLQLLRDQCAKSESHRYYEVTPSTEAASLCRKNLQ
GYINILKRQVEEVQELISRQNRITLAQREQAEFEQLLRFLHCEEQAAFSGLEEEEEKKEK
KLFGNIAPLECYGSVLRDLLSQVMLTGGLSEAKVLFTVKDFYLKAMSHQPNHFPIQLREA
YNFPLQYSALWKVIQQFTDHVTLDPKTAHPNLLISEARTCVTYTKERQCVPGFSRFTKSP
VMLGIPRFNSGRHFWEVQGGKKLEWAVGICKADLS
Download sequence
Identical sequences ENSRNOP00000061306 10116.ENSRNOP00000061306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]