SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000061816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000061816
Domain Number 1 Region: 44-154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000663
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000061816
Sequence length 222
Comment (Rattus norvegicus)
Sequence
MALLVSLPEQNLAMAWILLLLLSAACLHTGNSLGYPKEYDYGVNQPEHLTGIQGGSIEIP
FSFYFPWELAKDPNMSIAWRWKDFFGEAIYNSTLLLFHEHFKGRLILNWTQGETSGVLRI
LNLKKNDQSTYFGRVFLQTTEGMKFWQSMLGTKLIIHALTTTPGSPSIIPSAIPTAGLED
TRDQRNPSLLNLGVMVGMVMAKVVVIMPLCGWMIFLWWKQRN
Download sequence
Identical sequences B0BNH8
10116.ENSRNOP00000060008 10116.ENSRNOP00000061816 ENSRNOP00000061816 NP_001108516.1.100692 NP_001108516.1.4139 XP_017454103.1.100692 NYSGRC-IgSF-ENSRNOP00000060008 ENSRNOP00000060008 ENSRNOP00000061816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]