SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000061869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000061869
Domain Number 1 Region: 3813-4013
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.04e-36
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 2 Region: 3330-3441
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-32
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 1128-1256
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-31
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 3224-3328
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-29
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 2277-2383
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 3120-3223
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-28
Family Cadherin 0.00034
Further Details:      
 
Domain Number 7 Region: 2804-2912
Classification Level Classification E-value
Superfamily Cadherin-like 5.23e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 1021-1139
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-28
Family Cadherin 0.00054
Further Details:      
 
Domain Number 9 Region: 922-1025
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 3018-3126
Classification Level Classification E-value
Superfamily Cadherin-like 4.84e-27
Family Cadherin 0.00076
Further Details:      
 
Domain Number 11 Region: 1557-1658
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-26
Family Cadherin 0.00099
Further Details:      
 
Domain Number 12 Region: 1760-1880
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 138-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 14 Region: 817-920
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-24
Family Cadherin 0.00071
Further Details:      
 
Domain Number 15 Region: 2070-2177
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 16 Region: 710-815
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 17 Region: 458-559
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-23
Family Cadherin 0.00097
Further Details:      
 
Domain Number 18 Region: 1451-1555
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-22
Family Cadherin 0.00095
Further Details:      
 
Domain Number 19 Region: 2912-3016
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 20 Region: 3429-3548
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 21 Region: 2177-2284
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 22 Region: 1659-1780
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 23 Region: 2384-2484
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 24 Region: 2487-2597
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 25 Region: 2585-2695
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 26 Region: 1359-1457
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-18
Family Cadherin 0.0063
Further Details:      
 
Domain Number 27 Region: 1873-1971
Classification Level Classification E-value
Superfamily Cadherin-like 1.22e-16
Family Cadherin 0.0028
Further Details:      
 
Domain Number 28 Region: 1240-1352
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 29 Region: 1979-2082
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000542
Family Cadherin 0.0022
Further Details:      
 
Domain Number 30 Region: 563-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000393
Family Cadherin 0.0037
Further Details:      
 
Domain Number 31 Region: 2701-2802
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000214
Family Cadherin 0.0039
Further Details:      
 
Domain Number 32 Region: 3542-3633
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0072
Further Details:      
 
Domain Number 33 Region: 368-454
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000514
Family Cadherin 0.0034
Further Details:      
 
Domain Number 34 Region: 4093-4132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family EGF-type module 0.016
Further Details:      
 
Domain Number 35 Region: 4128-4167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000444
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 36 Region: 4054-4090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 37 Region: 34-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000414
Family Cadherin 0.0055
Further Details:      
 
Domain Number 38 Region: 4016-4053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.011
Further Details:      
 
Domain Number 39 Region: 246-357
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000314
Family Cadherin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000061869
Sequence length 4589
Comment (Rattus norvegicus)
Sequence
MGRHLALLLLLLLFLQHFGDGDGSQRLEPTPSLQFTHVQYNVTVHENSAAKTYVGHPRKM
GIYILDPSWEIRYKIISGDNENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLV
IKAVEKVTDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIG
TNGEFYYSFKDRTDMFAIHPTSGVVVLTGRLDVLETQRYELEILAVDRGMKLYGSSGVSS
LAKLTVHVEQANECAPEITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDL
LQQFKTVRSFPGSKAFKVKAVGGVDWDSHPYGYNLTVQAKDKGTPPQFSPVKVIHVISPQ
FRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLRYVFKSTPGKPKFGLNHNTGL
ISILEPIKRQHTTHFELEVTTSDRRASTKVVVKVVGTNSNPPEFTQTSYKASFDENAPVG
TPVMRVSAVDPDEGENGYVTYSIANLNHVPFVIDHFTGAVSTSENLDYELMPRVYMLRIR
ASDWGLPYRREVEVLATITLNNLNDNTPLFEKTNCEGTIPRDLGVGEQITTVSAIDADEL
QLVRYQIEAGNELDLFGLNPSSGVLSLKHSLMDGLGAKVSFHSLRITATDGENFATPLYI
NLTVAASRKPVNLRCEETGVAKMLAEKLLQANKLHHQGDAEDIFFDSHSVNAHAPQFRGS
LPTGIEVKEDLPVGASILFMNATDLDSGFNGKLVYAISGGNDDSCFTVDMETGMLKVLSP
LDREVTDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEINS
EIIQVEATDKDLGPSGHVTYAILTDTEKFAIDRVTGVVKIIQPLDREVQRVHYLKIEARD
QATEEPWLSSTVLLKVSLDDVNDNPPRFIPPSYSVKVREDLPEGTIIMWLEAHDPDVGQS
SQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPASLSSTGYVE
VEVVDVNENLHAPVFSSFVEKGTVKEDVPMGSSVMTVSAHDEDTGRDGEIRYSIRDGSGV
GVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQT
SEPVYYPEIMENSPKDVSVVQIEAFDPDSSSSDKLTYRITSGNPQGFFSIHPKTGLITTT
SRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREK
ADGDRSAKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGE
YDILSIKAIDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESVFSFTVMESDPVAHMIGV
ISVEPPGMPLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTSTIL
TQVLIKVIDTNDHRPQFSTSKYEVSVPEDTEPETEILQISAVDRDEKNKLIYTLQSSIDP
ASLKKFRLDPATGALYTSEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIIVNVSDMNDHS
PWFTSSSYEGRVYESAAVGSVVLQVTALDRDKGRNAEVLYSIESGNIGNSFTIDPILGSI
KTARELDRSHQVDYDLMVKATDKGEPPMSEMTSVRISVTVADNASPKFTSKEYSAEISEA
IRIGSFVGMVSAHSQSSVMYEVKDGNIGDAFNINPHSGSIVTQRALDFETLPIYTLTVQG
TNMAGLSTNTTVVVHIQDENDNPPAFTRAEYSGFISESASVNSVVLTDKNVPLVIRATDA
DRESNALLVYQIVEPSVHNYFAIDPTTGAIHTVLSLDYEETRVFHFTVQVHDMGTPRLFA
EYAANVTVHVIDINDCPPVFSKSLYEASLLLPTYKGVNVITVNATDADSRAFSQLIYSIT
KGNIGEKFSMDHKTGTIAIQNTTQLRSRYELTVRASDGRFTSVASVRINVKESRESPLKF
TQDAYSAVVKENSTEAKTLAVITAIGNPINEPLFYRILNPDRRFKISHTSGVLSTTGIPF
DREQQETFVVVVEVTKEREPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHV
IRHVTAIDRDSGRNGDVHYYLKEHHDHFEIGPSGDISLKKQFEHDTLNKEYLVTVVAKDG
GNPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENVQTHSPVVHVQANSPEGLKVFYSIT
DGDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIVVEDINDN
PPVFVQQSYSTTLSEASVIGAPILQVRATDSDSEPNRGISYQLIGNHSKSHDHFHIDSHT
GLISLVRALDYEQFQQHKLLVRAVDGGMPPLSSDVVVTVDVTDLNDNPPLFEQQVYEARI
SEHAAHGHFVMCVKACDADRSDLDRLEYSILSGNDHKSFVIDGETGIITLSNPRRHTLKP
FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKATDR
DSGIYGHLTYHLVNDFAKDRFYVNDGGQVFTLERLDREAPAEKVISVRLMAKDAGGKVAF
CTVNVILTDDNDNAPQFRSTKYEVNVGSSAAKGTSVVKVFASDADEGSNADVTYAIEADS
ESVEENLEINQLTGLITTKESLIGLENEFFTFFVRAVDNGSPPKESVVPVYVKILPPEVQ
LPRFSEPFYTYSISEDMPIGTEIDLIRVEHSGTVLYTLVKGNTPESNRDEFFVIDRQSGR
LKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESNPYEAFIV
ENLPAGSRVIQVRASDLDSGVNGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEE
RASYQIKVVASDHGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAI
LSTTDADSEEINRQVSYFITGGDALGQFAVENMQNDWRVYVKKPLDREQKDSYLLTVTAT
DGTFSSKARVEVKVLDANDNSPVCERTAYSDAIPEDALPGKLVMQVSATDADIRSNAEIT
YTLFGSGAEKFKLNPDTGELRTLALLDREEQAVYHLLVKATDGGGRSCQATIVLTLEDVN
DNTPEFTADPYAITVFENTEPGTPLTRVQATDADAGLNRKISYSLLDSADGQFSINEQSG
ILQLEKHLDRELQAVYTLTLKAADQGLPRKLTATGTVVVSVLDINDNPPVFEYREYGATV
SEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIENLDYESSH
GYYLTVEATDGGTPSLSDVATVNINITDINDNSPVFSQDSYTTVVSEDAALEQPVITIMA
DDADGPSNSHILYSIIEGNQGSPFTIDPVRGEIKVTKPLDRETISGYTLTVQAADNGNPP
RVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKDSSHNGPPFSFA
IVSGNDDNMFEVNQHGVLLTAATVKRKVKDHYLLHVKVADNGKPQLSSLTHIDIRVIEES
IHPPAILPLEIFITASGEEYSGGVIGKIHATDQDVYDTLTYSLDPHMDGLFSVSSTGGKL
IAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTIAIRFANLTPEEFVGDY
WRNFQRALRNILGIRKNDIQIVSLQPSEPHSHLDVLLFVEKSGGTQISTKQLLHKINSSV
TDIEEIIGVRILDVFQKLCAGLDCPWKFCDEKVSVDENIMSTHSTARLSFVTPRHHRTAV
CLCKDGTCPPVHQGCEDNPCPAGSECVADPREEKYSCVCPGGGFAKCPGSSSITFTGSSF
VKYRLMENENRLEMKLTMRLRTYSSHAVVMYARGTDYSILEIHTGRLQYKFDCGSGPGIV
SVQSIQVNDGQWHAVSLEVEGNYAKLVLDEVHTASGTAPGALKTLNLDNYVIFGGHLRQQ
GTKHGRNTQVANGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWVDLAHGCLLTATEDCSS
NPCQNGGVCNPSPTGGYYCKCSALHAGTYCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCR
GLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECAGNPCRNG
ALCENTHGSYHCNCSQEYRGKHCEDATPNHYVSTPWNIGLAEGIGIIVFIAGIFLLVVVF
VLCRKMISRKKKHQAEPEDKRLGPTTAFLQRPYFDSKPSKNIYSDIPPQVPVRPISYTPS
IPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSD
SDSIQKPSWDFDYDAKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDN
GYHWDTSDWMPSVPLPDIQEFPNYEVIDEHTPLYSADPNAIDTDYYPGGYDIESDFPPPP
EDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPVDMS
EPQKQGAGENSTCREPYTPYPPGYQRNFEAPTIENMPMSVYTSTASCSDVSACCEVESEV
MMSDYESGDDGHFEEVTIPPLDSQQHTEV
Download sequence
Identical sequences G3V9W9
10116.ENSRNOP00000061869 ENSRNOP00000061869 ENSRNOP00000050005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]