SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000062287 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000062287
Domain Number 1 Region: 60-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-35
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 2 Region: 666-828
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.12e-35
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 244-411
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-34
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 4 Region: 858-1062
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-27
Family Laminin G-like module 0.0097
Further Details:      
 
Domain Number 5 Region: 1-68
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-18
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0033
Further Details:      
 
Domain Number 6 Region: 468-527
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000549
Family Fibrinogen C-terminal domain-like 0.0055
Further Details:      
 
Domain Number 7 Region: 440-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000097
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000062287
Sequence length 1197
Comment (Rattus norvegicus)
Sequence
MFSDTGHNWQQYKQKDSIWTFVGNTNADGVVYHKLLHSMRARFVRFVPLEWNSNGKIGMR
VEVYGCSYKSDIVGFDGQSTLLYRFNQKTMSTLKDVISLKFKSMQGDGVLFHGEGQRGDH
ITLELQKGRLALYLNIDGSKARLSIIAPLAILGSLLDDQHWHSVLLERVGKQANFTVDRN
TQHFQIKGETDALDIDYELSFGGIPVPSKPGTFLKKNFHGCIENVYYNGVNIIDLAKRRK
HQIYSGNVTFSCSEPEIVPITFVNSRSSYLLLPGIPQIHGLSVSFHFRTWNEDGLLLSTE
LSEGSGTLLLILDGGSLRLLIKKVARHGTEIITGSSLNDGLWHSVSINARRNRVTLTLDN
DAASPALDTSQLQIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISV
QQGSMGNFSDLHIDLCSIKDRCLPNYCEHGGHCAQNWTTFYCNCSDTGYTGATCHDSVYE
QSCEVYRHKGHTAGFFYVDSDGSGPLGPLQVYCNITEDKIWMTVQHNNTELTWVQISNAE
KAYAMTFNYGGSMEQLEALIDGSEHCEQEVTYYCRRSHLLKTPDGAPFTWWIGRSNKRHN
YWEGSVPRVQQCRCVHKENCLDIRSFCNCDADIGEWAKETGFLSFKDHLPVTQIITTDTN
RSKSEAAWKIGPLRCYGDRHFWNAVSFTTEASYLYFPTFHAEFSADISFFFKTTALSGVF
LENLGIKDFLRLEMSSPSEITFTIDVGNGPVELLIQSPYPLNDNQWHYIRAERNLKETSL
QVDNLPQSMREASEEAYFRLHLTSQLFVGGTSSRQKGFLGCMRSLHLNGQNTDLIERAKL
MSGVTPGCLGHCSSYGSNCLNGGKCVEKQSGYSCDCTNSPNEGPFCQKEISALFNSGTSV
TYLFQEPYLVIKNTSLLSSPIYADTAPSKETIMLNFLTTQAPTILLYLNFSSQNFLAILL
SRNGDLQICFRLSKIESHVYTMNTENLANGRVHQVKINKDGPELSIQMDQQLFTYNFSPK
VEFWTLKSLVLGKVTETLGLDPEVAKVNILGFVGCLSSVQYNHIAPLKAALRHSGIAPVT
VQGTLTESGCDSTLDSDVNAVTTVHSSLDPIGKRDEREPLTDTVQSDSAVIGGIIALVTF
VTFCVIGIMIHFLYLHKQSHCTNQTKEKEYSENLSNSFRNAIDLQNTASECKREYFI
Download sequence
Identical sequences ENSRNOP00000062287 10116.ENSRNOP00000062287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]