SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000063092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000063092
Domain Number 1 Region: 261-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-22
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 10-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0000003
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000063092
Sequence length 437
Comment (Rattus norvegicus)
Sequence
MELAAGLANLQAEAYCICKNYFKNPVTMECGHEVCPSYIIVFWKDLKGGFPCLSCHLNQQ
GRNLSNQPPGELTGVTMVPPPQKKSSREWQEGKLSSGEPQQASCLLHSFPPSHLVVPMEN
ASLCHRKQIDFSVQLWREMVESVQKVIATQGRRSLELRKRAEHRREEMKSQCEQDEQEKI
LEQLQSREMNGLAKLKKKKQKTKNLAKLPASVKKDKSDLALLASVTDLYERYKHSGWPEI
ASVKQRGYDYKLPLQYSDLDRIIKQFQGDGILDPETANRLVSKDKKADQYGTGMVSYSTR
RFRCYPAILGSEGDSLDRQYWDVNAEHKFEWLLGVCREPFPGHGNDERLSVQDGLWGVGL
NDLANYVALGHEKNLLSKVAPNRIGNFLESEMHEFFYTLSVKSLLHRLSDCPSGTCWPLF
YTGSTYPLKLCTVADPE
Download sequence
Identical sequences ENSRNOP00000063092 ENSRNOP00000063092 10116.ENSRNOP00000063092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]