SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000063135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000063135
Domain Number 1 Region: 29-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-62
Family Calnexin/calreticulin 0.0000919
Further Details:      
 
Domain Number 2 Region: 200-314
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.57e-41
Family P-domain of calnexin/calreticulin 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000063135
Sequence length 433
Comment (Rattus norvegicus)
Sequence
MPEPKGPGPAGLSRAQVQTDGEDVSGGCRDGWTKRWVQSKHQSDYGKFRLDSGKFYQDKE
RDKGLQTTEDAKFYALSARFKPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPATLNQED
MHSESQYYIMFGPDICGFGNNRLQVILYHRGKYHENNKTLKCRINKDTHLYTLILRPNAT
YEVKIDNEKVTGGELEADWDFLPPKKIKDPYARKPRKWDERLQIEDPEDKKPEDWQDSEF
IPDPDAKKPDDWNEAMDGVWEGPLIPNVKYKGEWKPRIIDNPNYQGEWIHPEIDNPKYRP
DPTICHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWRELY
EEMEKQKEAEEAKKKREKQRAKQEDIWGLDEEDEEENEEDAEEEAEERPKQEGSGERASV
DQKEAHFEQKDEL
Download sequence
Identical sequences 10116.ENSRNOP00000063135 ENSRNOP00000054042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]