SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000063600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000063600
Domain Number 1 Region: 895-1075
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 482-686
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 698-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-34
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 4 Region: 288-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 27-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-29
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 6 Region: 1108-1248,1277-1319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.21e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000063600
Domain Number - Region: 210-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000364
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000063600
Sequence length 1729
Comment (Rattus norvegicus)
Sequence
MALGSRWRPPPQLPPLLLLLALVAGVRGLEFGGGPGQWARYARWAGAASTGELSFSLRTN
ATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRD
ARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLA
NLKLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKF
CSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
DLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEAL
VEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTM
LGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQG
DLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGA
GVGSHSSSQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKG
SISVNSRSTPFLATGESEVLDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRD
LFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTG
FLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADT
LRLELDGGQMKLTVNLDCLRVGCAPSAAGKGPETLFAGHKLNDNEWHTVRVVRRGKSLQL
SVDNVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCK
DGDITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLF
NSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLK
IDSRTVTQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPD
LIADALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGT
TYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQ
GTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDN
ERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNG
LKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTT
RRGRSPTMRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDDPPPV
ATRSPFVPPPPTFYPFLTGVGATQDTLPPPAARRPSSGGPCQAERDDSDCEEPVEASGFA
SGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLLAPSAP
APNLPAGKMNHRDPLQPLLENPPLGPGVPTAFEPRRPPPLRPGVTSVPGFPRLPTANPTG
PGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRCRKSPREEKLLPG
SAQGLGLDLAKACCVCRCRATCIAGKPLEERGGGRGEGERQMQIYIKNK
Download sequence
Identical sequences 10116.ENSRNOP00000063600 ENSRNOP00000063026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]