SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000063713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000063713
Domain Number 1 Region: 6-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-70
Family Calponin-homology domain, CH-domain 0.000000877
Further Details:      
 
Domain Number 2 Region: 3054-3177
Classification Level Classification E-value
Superfamily EF-hand 7.91e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3179-3275
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 974-1130
Classification Level Classification E-value
Superfamily Spectrin repeat 3.18e-24
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 2029-2186
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-21
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 3255-3343
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 7 Region: 2494-2655
Classification Level Classification E-value
Superfamily Spectrin repeat 5.49e-20
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1081-1241
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 9 Region: 2720-2847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 10 Region: 316-425
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 1191-1345
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-17
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 12 Region: 2870-3008
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-17
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 13 Region: 1497-1652
Classification Level Classification E-value
Superfamily Spectrin repeat 5.26e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 14 Region: 394-533
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 500-638
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-16
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 16 Region: 2243-2390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000136
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 17 Region: 754-877
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000208
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 18 Region: 1626-1750
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000475
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 19 Region: 1801-1943
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000006
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 20 Region: 3016-3053
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 21 Region: 2423-2511
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000108
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000063713
Domain Number - Region: 896-988
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000063713
Sequence length 3654
Comment (Rattus norvegicus)
Sequence
WLDKNFYKFGKQHIDNLFSDLQDGKRLLDLLEGLTGQKLPKEKGSTRVHALNNVNKALQV
LQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKTIMAGLQQTNSEKILLSW
VRESTRNYPQVNVLNFTSSWSDGLALNALIHSHRPDLFDWNSVVSQQSATQRLEHAFNIA
KCQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIREVEMLPRPSKVTRE
EHFQLHHQMHYSQQITVSLAQGYEQTSSSPKPRFKSYAFTQAAYVATSDSSQSPYPSQHL
EAPGSKSFGSSLIETEVNLDSYQTALEEVLSWLLSAEDTLRAQGEISKDVEEVKEQFHAH
EGFMMDLTSHQGLVGNVLQLGSRLVGKGKLTEDEETEVQEQMNLLNSRWECLRVASMEKQ
SNLHKVLMDLQNQKLKELDDWLTKTEERTKKMEEEPLGPDLEDLKCQVQQHKVLQEDLEQ
EQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICKWTEDRWILLQDILLKWQ
RFTEEQCLFSKWLSEKEDAMKNIQTSGFEDQNEMVSSLQNISALKIDLEKKKQSMEKLSS
LNQDLLSALKNKSVTQKMEMWMENFAQRWDNLTQKLEKSSAQISQAVTTTQPSLTQTTVM
ETVTMVTTREQIMVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDITELHSWITRSEAVL
QSSEFAVYRKEGNISDLKEKVNAIAREKAEKFRKLQDASRSAQALVEQMVNEGVNAESIR
QASEQLNSRWTEFCQLLSERVNWLEYQNNIITFYNQLQQLEQMTTTAENLLKTQPTTLSE
PTAIKSQLKICKDEVNRLSALQPQIERLKIQSLTLKEKGQGPMFLDADFVAFTNHFNYVF
DGVRAREKELQTIFDTLPPMRYQETMSSIRTWIQQSENKLSIPHLSVTEYEIMEERLGKL
QALQSSLKEQQNGFNYLNATVKEIAKKAPSEISQKYQSEFEEVEGRWKKLSTQLVEHCQK
LEEHMNKLRKFQNHKKTLQKWMAEVDVFLKEEWPALGDAEILKKQLKQCRLLVGDIQTIQ
PSLNSVNEGGQKIKSEAEFEFASRLEKELKELNTQWDHICRQVYTRKEALKAGLDKTVSL
QKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEALQKEAKVKLLTETVN
SVISQAPPAAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWL
NEVELKLKATENVPAGAEEITEVLESLENLMHHSEENPNQIRLLAQTLTDGGVMDELINE
ELETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKSLHLIQESLEFIDKQLAAYIADKVD
AAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKDANQRVLSQIDVAQKKLQDVSIKFRLFQ
KPANFEQRLEESKMILDEVKMHLPALETKSVEQEVVQSQLSHCVNLYKSLSEVKSEVEMV
IKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNV
LTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKAHLKSVTELGDSLKTVL
GKKETLVEDKLTLLNSNWIAVTSRVEEWLNLLLEYQKHMESFDQNVEHITKWIIHTDELL
DESEKRKPQQKEDILKRLKAEMNDIRPKVDATRDQAAKLMANRGDYCRKIVEPQISELNR
RFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMSEDNEG
TVNELLQRGDNLQQRITDERKREEIKLKQQLLQTKHNALKDLRSQRRKKALEISHQWYQY
KSQADDLLKCLDEIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAESLSENGAA
MAVEPTQIQLSKRWREIESNFAQFRRLNFAQIHTLHEETMVVTTEDMPLDVSYVPSTYLT
EISHILQALSEVEQLLNAPELNAKDFEDLFKQEESLKNIKENLQQISGRIDVIHKKKTAA
LQSATPMERVKLQEAVSQMDFHWEKLNRMYKERQGRFDRSVEKWRHFHYDMKVFNQWLND
VEQFFKKTQNPENWEHAKYKWYLKELQDGIGQRQAVVRTLNATGEEIIQQSSKTDANILQ
EKLGSLSLRWHEVCKELAERRKRVEEQKNVFSEFQRDLNEFVSWLEEADNIATTPPGDEE
QLKEKLEQVKLLTEELPLRQGILKQLNETGGAVLVSAPIRPEEQDKLEKKLKQTNLQWIK
VSRALPEKQGELEVHIKDFRQFEEQLDHLLLWLSPIRNQLEIYNQPSQPGPFDLKETEVT
VQAKQPDVERLLSKGQHLYKEKPSTQPVKRKLEDLRSEWEAVNHLLWELRTKQPDRAPGL
STTGASASQTVTVVTQPVDTKETVISKLEMPSSLLLEVPALADFNRAWTELTDWLSLLDR
VIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNKTSNQEARTIIT
DRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLEAKEEAEQVIGQARGKLDSWKEGPH
TMDAIQKKITETKQLAKDLRQRQINVDVANDLALKLLRDYSADDTRKVHMITENINTSWG
NILKRVSEREAALEETQRLLQQFPLDLEKFLAWITEAETTANVLQDASRKEKLLEDSRGV
RELMKPWQDLQGEIEAHTDIYHNLDENGQKILRSLEGSDEAPLLQRRLDNMNFKWSELRK
KSLNIRSHLEVSSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQKQNDVHRAF
KRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEERAQNVTRLLRKQAEEV
NTEWDKLNLHSADWQRKIDEALERLQELQEAADELDLKLRQAEVIKGSWQPVGDLLIDSL
QDHLEKVKALRGEIAPLKENVNHVNDLAHHLTTLGIQLSPYNLSILEDLNTRWRLLQVAV
EDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTEL
YQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQII
NCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHL
EDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFAN
NKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKH
FNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPR
MGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEHYASRLAEMENSN
GSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLESEERGELERILA
DLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGR
LEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRV
VGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNAPGKPMREDTM
Download sequence
Identical sequences 10116.ENSRNOP00000063713 ENSRNOP00000029969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]