SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000063778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000063778
Domain Number 1 Region: 1011-1212
Classification Level Classification E-value
Superfamily vWA-like 3.97e-59
Family Integrin A (or I) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 155-339
Classification Level Classification E-value
Superfamily vWA-like 4.3e-57
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1231-1434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-33
Family Laminin G-like module 0.05
Further Details:      
 
Domain Number 4 Region: 448-614
Classification Level Classification E-value
Superfamily Fibronectin type III 7.31e-23
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 740-910
Classification Level Classification E-value
Superfamily Fibronectin type III 7.26e-20
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 355-441
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-17
Family Fibronectin type III 0.00093
Further Details:      
 
Domain Number 7 Region: 31-115
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000419
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 631-713
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000268
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 922-1006
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000154
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000063778
Sequence length 1797
Comment (Rattus norvegicus)
Sequence
MTILQCKMRAWLILAFLAVAYFCTIVRGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVAPASGGKTNQMNLQNGATKAIIQGLLPEQNYTVQLIAYYKDKESKPAQGQFRIKDL
EKRKDPTKPRVKAVDKGNGSKSTSPEEIKFFCETPAIADIVILVDGSWSIGRFNFRLVRN
FLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRSLPYKGGNTLTGL
ALNFIFENSFKPEAGSRSGVSKIGILITDGKSQDDIIPPSRNLREAGVELFAIGVKNADL
SELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDKEIKASALATIGPPTEL
ITSEVTARSFMVNWTHSPGKVEKYRVVYYPTRGGKPEEVVADGRVSSIVLKNLMSSTEYQ
IAVFAVSAHTASEGLRGTETTLALPMASDLELYDVTENSMRVKWDAVPGATGYLILYAPL
TEGLAGDEKEMKIGETHTDIELSGLFPNTEYTVTVYAMFGEEASDPATGQETTLPLTPPR
NLRISNVGSNSARLTWDPTSGKITGYRIVYTSADGTEINEVEVDPITTFPLKGLTPLTDY
SIAIFSIYEEGQSLPLVGEFTTEEVPAQQYLEIDEVKTDSFRVTWHPLSAEEGQHKLMWI
PVYGGKTQEVALKEEQDSYVVEGLDPGTEYEVSLLAVLDDGSESEVVTAVGTTLDDFWTE
APTTVEPTSPVTSVLQTGIRNLVVDDEAATSLRVTWDISDSNVEHFRVTYLTAQGDPKEE
VVGTVMVPGVQNSLLLKNLLPDTEYKVTVTPIYTVGEGVSVSAPGKTLPTSGPQNLRVSE
EWYNRLRITWDPPSAPVKGYRIVYKPVSVPGQTLETFVGADVNTIVMTNLLSGMDYNVKI
FASQAAGYSDALTGLVQTLFLGVTDLQANQVEMTSLCARWQIHRHATAYRIVLESLQDTQ
AQESTVGGGVNRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMQKTQSLPTEPPTFPPTI
PPAKEVCKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTD
DPRTEFKLDAYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTADSGTRRGIPKVIV
VITDGRSQDDVNKISREMQADGYNIFAIGVADADYSELVRIGSKPSSRHVFFVDDFDAFK
KIEDELITFVCETASATCPMVHKDGVDIAGFKMMEMFGLVEKDFSAVEGVSMEPGTFNLF
PCYQIHKDALVSQPTKYLHPEGLPADYTMTFLFRILPDTPQEPFALWEILNKKSEPLVGI
ILDNGGKTLTYFSYDYTGDFQTVTFEGPDIXKMFYGSFHKLHVVVSKTLAKVVVDCKEVG
QKAINASANITSDGVEVLGRMVRSRGPNGNSAPFQLQMFDIVCSTSWASKDRCCELPGLR
DEESCPDLPRSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPEGPRGETGPAGP
QGPPGPQGPSGLSIQGMPGMPGDKGDKGDAGLPGPQGVPGGVGSPGRDGSPGQRTFPNSA
GSQRPPGQPNPVGGRAKPSIPGIEDSLYPQGTVGSEGVPGAKGERGERGDLQSQAMVRAV
ARQVCEQLIQSHMARYTAILNQIPSQSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGAPGF
PGNAGVPGTPGERGLTGVKGDKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRG
PPGHLGVPGPQGPSGQPGYCDPSSCSAYGVGVSHPDQPEFTPVQDEQEALDLWSAGI
Download sequence
Identical sequences ENSRNOP00000035054 10116.ENSRNOP00000063778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]