SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000299
Domain Number 1 Region: 36-157
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.85e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000299
Sequence length 325
Comment (Cavia porcellus)
Sequence
HGYFFASTEIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRG
NSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAY
ARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSETTDVPVVRGKPTLRTRGVPTPA
ITRGRGTVTARPVGVGVPRGTPTTRGVLSTRGPVTRGRGLLTPRARGVPPTGYRPPPPPP
TQETYGEYDYDDGYGAAYDEQSYDSYDNSYSTPARSGADYYDYGHGLSEETYDSYGQEEW
TNSRHKAPAARTAKGVYRDQPYGRY
Download sequence
Identical sequences ENSCPOP00000000299 ENSCPOP00000000299 10141.ENSCPOP00000000299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]