SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000593 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000593
Domain Number 1 Region: 712-878
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-47
Family MAM domain 0.00023
Further Details:      
 
Domain Number 2 Region: 216-307
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-17
Family I set domains 0.005
Further Details:      
 
Domain Number 3 Region: 321-423
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000118
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 416-518
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000151
Family I set domains 0.047
Further Details:      
 
Domain Number 5 Region: 26-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000038
Family I set domains 0.069
Further Details:      
 
Domain Number 6 Region: 513-593
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000019
Family I set domains 0.043
Further Details:      
 
Domain Number 7 Region: 107-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000629
Family I set domains 0.031
Further Details:      
 
Domain Number 8 Region: 172-218,594-702
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000705
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000593
Sequence length 917
Comment (Cavia porcellus)
Sequence
APAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQCLVTGHPRPQVRWTKTAGSASDK
FQETSVFNETLRIERVARTQGGRYYCKAENGVGVPAIKSIRVDVQYLDEPVLTVHQTVSD
VRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEPLYTQGETKVLKLK
NLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPPALKLSVNETLVVNPGDNVTVQC
LLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTV
NLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVDAVPQEKVTYQWFKNGKPARMSK
RLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCVASFPGAPVSDLSVEVNISSETVPPTI
SVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDKEAALLPSGLALEETQDGKLRLE
RVTRDMSGTYRCQTARYNGFNVRPREAQVQLNVQFPPEVEPESQDVRQALGRPVLLRCSL
LRGNPQRIATAVWRFKADHADLRLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPE
FYFDTPNPTRSHKLSKNYSYVLQWTQREPDAVDPVLNYRLSVRQLNQHNAMVKAIPVRRV
EKGQLLEYLLTDLRVPHSYEIRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDE
QICGYTQDLTDNFDWTRQNALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRA
RLVSPLYNASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGTLDTHAWSLSGNKGNVWQQA
HVPINPSGPFQIIFEGVRGSGYLGDIAIDDVTLKKGECPRKQMDPNKVVVMPGSGAPRQS
SLQLWGPMAIFLLALER
Download sequence
Identical sequences ENSCPOP00000000593 ENSCPOP00000000593 10141.ENSCPOP00000000593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]