SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000645
Domain Number 1 Region: 263-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-35
Family Laminin G-like module 0.00000774
Further Details:      
 
Domain Number 2 Region: 467-666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-27
Family Laminin G-like module 0.0000493
Further Details:      
 
Domain Number 3 Region: 41-93
Classification Level Classification E-value
Superfamily GLA-domain 4.54e-20
Family GLA-domain 0.00044
Further Details:      
 
Domain Number 4 Region: 119-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 238-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000898
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000645
Sequence length 673
Comment (Cavia porcellus)
Sequence
MRVLGGRCGALLACLALVLPVSEANFLSKQHASQVLVRKRRANTLLEETKEGNLERECIE
ELCNKEEAREVFENNPETDYFYPKYLACLGSFRAGLFTSARLSTNGYPDLRSCITAIPDQ
CDPLPCNKDGYMSCVDGQATFTCNCKPGWQGNMCEFECKDPLNVNGGCSQICDNTPGSYQ
CSCRSGFDLLSNKKDCRDVDECSKKPNVCGKAVCKNTPGDYICECPEGYRYEPKSGICTD
IDECAENMCAQLCVNYPGSYSCYCDGKKGFKLAQDQRSCEVIPVCLPLNLDKNYELLYLA
EQFAGVIIYLLRTSLCPLFRFSAKFDFRTYDSEGVILFAESLDHSAWLLIALRDGKLEIQ
LKNEFTTQITTGGAVINDGVWNMVSVEELKDSISIKIAKEAVMNINKPASLFKATNGFVE
TKIYFSGLPRKVAEALIRPINPRLDGCIRSWNLMNQGALGAKEIIQEKQNKHCLVTVEKG
SYYPGSGVAQFNIDYNNKTNAEGWQVNLTLNIRPSEGTGVMFALVSGNTVPFAISVVDST
SRNSQDIIVSVENTVVSRVEDVSLCSSQKSQVILGVNRNNLELWTPFKEKVVYSEDLQSK
LAILDEAMKGTVATYLGGIPDIPFSAMPVNAFYNGCMEVNVNGVQLDLDEAVSKHNDIRA
HSCPSVWNNTESS
Download sequence
Identical sequences ENSCPOP00000000645 10141.ENSCPOP00000000645 ENSCPOP00000000645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]