SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000693
Domain Number 1 Region: 888-1068
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 478-682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 694-884
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-34
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 4 Region: 284-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 27-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-29
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1101-1241,1270-1312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.62e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000000693
Domain Number - Region: 209-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000312
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000693
Sequence length 1695
Comment (Cavia porcellus)
Sequence
MAPGSRWRPPPPPLLLLVVLLAAGAGGLEFGGGPGQWARYARWTGAASSGELSFSLRTNA
TRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRDA
RRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTAKYEPPFRGLLAN
LKLGERPPALLGSQGLRGAAADPLCAPVRNPCANGGLCTVLAPGEVGCDCSHTGFGGKFC
SEEEHPMEEGPAHLTLNSEVGSLLFSGRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLSH
NPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEPV
NGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGSD
DFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSF
RCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGAGPGS
HSSAQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISV
NSRSTPFLATGESEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFID
GRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGR
VCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLE
LDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTV
EGQMAGAHTRLEFQNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYC
ELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGND
FIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVT
QHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALH
RIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPICNDPGTTYIFGKG
GALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIF
NVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIAR
QRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALA
AESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLAARRGRSPTLRDSTTQNTDDLLVASA
ECPSDDEDLEECEPSTGGHVLSATVPEHSLLSPRQTTQDPSQTLSPPPRDRPTEPGLGLT
LGLEPSTLALQPRVGEVLSASHRNSVTQQVCSLPVIRGPEAVKPWLGPGGESGDQSFHPS
YLPAISRASPPPPQSPAGDPCLLQCVSSSILHGPSVLTPGGGNSSSVLGEREPSEPESQS
PREVPRASEPQPLKARRSPPRRRGPSTPGFPGLPTSQPHGRGSGSPGAVEVIRESSSTTG
MVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAQAAPK
TPSKTKKNKDKEYYV
Download sequence
Identical sequences 10141.ENSCPOP00000000693 ENSCPOP00000000693 ENSCPOP00000000693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]