SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000000708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000000708
Domain Number 1 Region: 20-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-62
Family Calnexin/calreticulin 0.0000523
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.14e-45
Family P-domain of calnexin/calreticulin 0.000000612
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000000708
Domain Number - Region: 309-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.019
Family Calnexin/calreticulin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000000708
Sequence length 417
Comment (Cavia porcellus)
Sequence
MLLPVPLLLGLLGLAAAEPAVYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKDQTLVVQFTVKHEQNIDCGGGYVKLFPQNLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPNYKGTWIHPEVDNPEYS
PDAHIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGITKAAEKKMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKDDEDDKDEDEEDEEDKEEEEEEEATGQAKDEL
Download sequence
Identical sequences H0UUR0
ENSCPOP00000000708 ENSCPOP00000000708 10141.ENSCPOP00000000708 XP_003468401.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]