SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001015
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.63e-35
Family Calponin-homology domain, CH-domain 0.0000515
Further Details:      
 
Domain Number 2 Region: 176-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000413
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001015
Sequence length 832
Comment (Cavia porcellus)
Sequence
MAGPRGALLSWCRRQCEGYGGVEIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVF
ENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYHHFTSPGQAGVSPSRK
ELTASSPPLVAPSPAEPGDETQSEELSSGSLSEQGAQRAVQRYLAEGRLYHRHCFRCRQC
SGTLLPGAYKSGPEAGTFVCAERCTRLGPGGQAGARPGPPSQPKPQQLAEEARDGEEGGP
SSSVAAGRKAVPEARPHVPTKPPLPGKPQELSSPVSGRPTPAPRKASDSMAPTPPTPRPR
SSLQQDSTAEQGGSGGLVNGRLQEPPVPKPRGTPKLSERTPPARKDPPWITLVQAEPKKK
PAPLPPGSPRPPSRGSRQEENGTVEEVTPRGPAAGSEPRTYNPFEDEEEVEEPSPAAPSP
APSPAQAPSECTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPLALHASRLSHSEPPSAT
PSPALSVESLASESCSQMAAGELLEPPAVPKSSSEPAVHAPGTPGNSASLSAHSSLSSSG
ELVQPSVEQTPQARTRGSPGPQPAKPCSGAAATPLLVGDRSPAPSPGSSSPQLQVKSSCK
ENPFNRKPSPAASPTAKKATKGPKPARPPAPGHGFPLIKRKVQADQYVPEEDIYGEMDAI
ERQLDALEHRGVLLEEKLRGGASEGREDAMLVDWFKLIHEKHLLVRRESELIYIFKQQNL
EQRQADVEYELRCLLNKPEKDWTEEDKSREKVLLQELMTLIEQRNAIVNCLDEDRQREEE
EDKMLEAMIKRKEFQKEAESEGKKKGKFKTIKVLKMLGNKRDTKSKSPGDKS
Download sequence
Identical sequences ENSCPOP00000001015 ENSCPOP00000001015 10141.ENSCPOP00000001015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]