SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000001159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000001159
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.76e-18
Family Skp1 dimerisation domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily POZ domain 0.000000000746
Family BTB/POZ domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000001159
Sequence length 153
Comment (Cavia porcellus)
Sequence
MPCLQSSDGEIFEADVEFANLEKSRPLDDGDNDSVHLPYVNEAIFKKVIQWCTNRNNDPL
PPPKDAKNKEKLRDNILVWDQELLKVDQAMFFELFLATNYLDIKDSLDVTCKTVADMFKG
KTPKEIHKTFNIKKTAEEEKAQGCKESQWCEEK
Download sequence
Identical sequences ENSCPOP00000001159 ENSCPOP00000001159 10141.ENSCPOP00000001159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]