SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002729
Domain Number 1 Region: 255-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-23
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 2 Region: 72-191
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000003
Family Cadherin 0.0073
Further Details:      
 
Domain Number 3 Region: 26-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000471
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002729
Sequence length 867
Comment (Cavia porcellus)
Sequence
AGEICAFKIHGQELPFEAVVLNKTSGEGRLRARSPIDCELQKEYTFIIQAYDCGAGPREM
AWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSILQVEAIDEDCSPQFSQIC
NYEIITTDVPFAIDRNGNIRNTEKLSYDRQHQYEILVTAYDCGQKPAAQDTLVQVDVKPV
CKPGWQDWTKRIEYQPGSGSMPLFPNIHLETCDGAVSSLQVTTELQTNYIGKGCDRETYS
ERSLQKLCGASSGIIDLLPSPSSATNWTSGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLT
DQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADT
FRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLT
VGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQG
IKYHFNPSQSILVMEGEDIGNINHALQKVSYINSRQFPTAGVRRLRVSSKVQCFGEDVCI
SIPDVDAYVMVLQAMEPQITLQGTDHFWRPAAQFKSARGVILFPDIKIVSTFAKPDATGD
MKTTGTAPRSAVLEEMLHNLDFCDILVIGGDLDPRQECLELNHNELHQRHLDATNSTAGY
SIYGVGSMSRYEQVLHHLRYRNWQSSSLEARQFRIKCSELNGRYTSNEFNVKVSVLHEVR
VPDKEHVNHLIVQPPFLQSVHHPESRSSIQRTSVVPSIATVVIIISVCMLVFVVAMGVYR
VRIAHQHFIQETEAAKEAEMDWDDSALTITVNPMEKHVAPGHGEDETEGEEEEEEAEEDL
SSSSSEDNSEEEEEAGMGRGRHGQSGT
Download sequence
Identical sequences ENSCPOP00000002729 10141.ENSCPOP00000002729 ENSCPOP00000002729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]