SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002746
Domain Number 1 Region: 29-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-87
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-32
Family Spectrin repeat 0.000000775
Further Details:      
 
Domain Number 3 Region: 516-637
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-31
Family Spectrin repeat 0.00000463
Further Details:      
 
Domain Number 4 Region: 397-512
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.00000189
Further Details:      
 
Domain Number 5 Region: 745-872
Classification Level Classification E-value
Superfamily EF-hand 1.63e-22
Family Calmodulin-like 0.072
Further Details:      
 
Domain Number 6 Region: 641-752
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-19
Family Spectrin repeat 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002746
Sequence length 900
Comment (Cavia porcellus)
Sequence
MMMVMQPEGLGAGESPFAGENDPSLREKFEEWQRRESEDFRWQKMPRKTFTAWCNSHLRK
AGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQ
NFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDI
VNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELL
EWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRL
SHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHE
AWTRGKEDMLNQRDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYH
EAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDG
AVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAILGIQGEIQKICQTYGLRPA
TTNPYISLTPQDINTKWDMVRKLVPSRDQTLQEELSRQQVNERLRRQFAAQANAVGPWIQ
AKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHTV
YSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMME
PDDFRACLISMGYDLGEVEFARIMTMVDPNATGVVTFQAFIDFMTRETAETDTAEQVMAS
FKILAGDKNYITPEELRRELPAEQAEYCIHRMAPYKGSGAPAGALDYVAFSNALYGESDL
Download sequence
Identical sequences 10141.ENSCPOP00000002746 ENSCPOP00000002746 ENSCPOP00000002746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]