SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002895
Domain Number 1 Region: 120-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.91e-158
Family Calponin-homology domain, CH-domain 0.00000000307
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 1.82e-19
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002895
Sequence length 630
Comment (Cavia porcellus)
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
AVADNNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALENDPDCKHLLPMNPNDGSLFRSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTVSENLNLALNSASAIGCTVVNIGAQDLKEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLSEGEELEELMKLSPEELLLRWVNYHLTNAGWPTISNFSQDIKDSRA
YFHLLNQIAPKSDREDGPAIDIDLSGFNEKNDLKRAEFMLQEADKLGCRQFVTPADVVSG
NPKLNLAFVANLFNTYPCLHKPNNNDIDINLLEGESKEERTFRNWMNSLGVNPYINHLYG
DLEDALVIFQLYEMIRVPVNWSQVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGI
AGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGDGEKVNDEIIIKWVNQTLKNANKSTSI
SSFKDKSISTSLPVLDLIDAIVPNAVRQEMIKRENLSDEDKLNNAKYAISVARKIGARIY
ALPDDLVEVKPKMVMTVFACLMGKGLNRIK
Download sequence
Identical sequences H0V0A8
10141.ENSCPOP00000002895 XP_003476804.1.53824 XP_013015364.1.53824 XP_013015365.1.53824 XP_013015366.1.53824 ENSCPOP00000002895 ENSCPOP00000002895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]