SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000002949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000002949
Domain Number 1 Region: 62-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-86
Family Calnexin/calreticulin 0.00000000382
Further Details:      
 
Domain Number 2 Region: 271-411
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.34e-59
Family P-domain of calnexin/calreticulin 0.0000000338
Further Details:      
 
Domain Number 3 Region: 413-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000522
Family Calnexin/calreticulin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000002949
Sequence length 593
Comment (Cavia porcellus)
Sequence
MEGKWLLCVFLALGAVAVRAHDGHDEDMIDIEDDLDDVIEEVEDSKSKPDTSSLPPSPKV
TYKAPIPTGEVYFAESFDRGSLTGWILSKAKKDDTDEEIAKYDGQWEVDEMKETKLPGDK
GLVLVSRAKYHAISAKLNKPFGFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELSLDQ
FHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLY
TLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSQEIEDPEDRKPEDWDERPKIADPDA
VKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANP
KCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTP
FSAIGLELWSMTSDIFFDNFIISSERSVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAE
ERPWLWVVYILTVALPVFLVILFCCSGKKQSTAMEYKKTDAPQPDVKEEEEKEEEKDKGD
EEEEGEEKLEEKQKSDAEEDGGTISQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences H0V0G1
10141.ENSCPOP00000002949 ENSCPOP00000002949 ENSCPOP00000002949 XP_004999826.1.53824 XP_004999827.1.53824 XP_013010279.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]