SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003007
Domain Number 1 Region: 277-433,478-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-45
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000003007
Domain Number - Region: 48-96
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0115
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003007
Sequence length 565
Comment (Cavia porcellus)
Sequence
DANLVDVSGGLETESSNGKDTLEGAGDTSEVMDAQAGSVDEENGRQLGEVELQCGICTKW
FTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQ
DEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPG
SKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGITAGSSGKGRGAKRKQQ
DGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCW
AGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYF
EITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQG
DVLGFYISLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIF
YKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYHPMSDMGWGAVV
EHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences ENSCPOP00000003007 10141.ENSCPOP00000003007 ENSCPOP00000003007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]