SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003162
Domain Number 1 Region: 202-395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-42
Family Pentraxin (pentaxin) 0.00053
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000003162
Domain Number - Region: 89-159
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0157
Family Apolipoprotein A-I 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003162
Sequence length 405
Comment (Cavia porcellus)
Sequence
MRASRAARTCALLALCLLGTGAQDFGPTRFICTSVPVDADMCAASVAAGGAERELTTKLG
RCESQGVLDAGPGEARAGGGRKQLGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENL
EQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERIKIESALTS
LHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVRKSLPEMYAFTVCMWLKSSAAPGV
GTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWE
AYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLT
PGEVSNLATCSAKALSGNVIAWAESQIEIYGGATKWTFEACRQIN
Download sequence
Identical sequences ENSCPOP00000003162 10141.ENSCPOP00000003162 ENSCPOP00000003162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]