SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003279
Domain Number 1 Region: 2131-2261
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-34
Family Cadherin 0.00065
Further Details:      
 
Domain Number 2 Region: 3947-4153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-32
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 3 Region: 973-1096
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-31
Family Cadherin 0.00094
Further Details:      
 
Domain Number 4 Region: 2654-2764
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-29
Family Cadherin 0.00033
Further Details:      
 
Domain Number 5 Region: 1298-1401
Classification Level Classification E-value
Superfamily Cadherin-like 3e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 671-774
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-28
Family Cadherin 0.00064
Further Details:      
 
Domain Number 7 Region: 3384-3504
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-28
Family Cadherin 0.00084
Further Details:      
 
Domain Number 8 Region: 1193-1304
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-28
Family Cadherin 0.00033
Further Details:      
 
Domain Number 9 Region: 228-347
Classification Level Classification E-value
Superfamily Cadherin-like 7e-28
Family Cadherin 0.00066
Further Details:      
 
Domain Number 10 Region: 452-574
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-27
Family Cadherin 0.00076
Further Details:      
 
Domain Number 11 Region: 2346-2449
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-27
Family Cadherin 0.00027
Further Details:      
 
Domain Number 12 Region: 2035-2136
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-27
Family Cadherin 0.00086
Further Details:      
 
Domain Number 13 Region: 3074-3185
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 14 Region: 1922-2045
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.00059
Further Details:      
 
Domain Number 15 Region: 1397-1524
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 16 Region: 3173-3281
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-27
Family Cadherin 0.00076
Further Details:      
 
Domain Number 17 Region: 1824-1933
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-27
Family Cadherin 0.00077
Further Details:      
 
Domain Number 18 Region: 870-975
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-26
Family Cadherin 0.00062
Further Details:      
 
Domain Number 19 Region: 4169-4391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-26
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 20 Region: 564-670
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-26
Family Cadherin 0.00079
Further Details:      
 
Domain Number 21 Region: 2242-2353
Classification Level Classification E-value
Superfamily Cadherin-like 5e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 22 Region: 1722-1823
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-24
Family Cadherin 0.00055
Further Details:      
 
Domain Number 23 Region: 2968-3071
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-22
Family Cadherin 0.00072
Further Details:      
 
Domain Number 24 Region: 777-882
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 25 Region: 2857-2966
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 2445-2559
Classification Level Classification E-value
Superfamily Cadherin-like 3e-22
Family Cadherin 0.0025
Further Details:      
 
Domain Number 27 Region: 2758-2855
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 28 Region: 1077-1191
Classification Level Classification E-value
Superfamily Cadherin-like 5e-21
Family Cadherin 0.0026
Further Details:      
 
Domain Number 29 Region: 3494-3597
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-20
Family Cadherin 0.001
Further Details:      
 
Domain Number 30 Region: 3283-3388
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 31 Region: 113-247
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-19
Family Cadherin 0.0029
Further Details:      
 
Domain Number 32 Region: 2556-2660
Classification Level Classification E-value
Superfamily Cadherin-like 6e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 33 Region: 335-456
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 34 Region: 1506-1612
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0027
Further Details:      
 
Domain Number 35 Region: 3798-3808,3839-3933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000439
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 36 Region: 1615-1729
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000928
Family Cadherin 0.0036
Further Details:      
 
Domain Number 37 Region: 37-117
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0061
Further Details:      
 
Domain Number 38 Region: 4418-4455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000211
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000003279
Domain Number - Region: 3599-3689
Classification Level Classification E-value
Superfamily Cadherin-like 0.00597
Family Cadherin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003279
Sequence length 4657
Comment (Cavia porcellus)
Sequence
RPWLPLHTLSGFQLLRVFWLLSLLSGPAWVHGAEQRQVFQVLEEQPPGTPVGTIQTRPGF
TYRLSESHALFAINASTGALYTTTTIDRESLPSDVINLVVLSSAPTYPTEVRVLVRDLND
NAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDIT
LNPSGEGAFLHLVSKGGLDREVTPNYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVF
GSSHYQGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFHMDPETGLITVREPL
DFEARRQYSLTVQAVDRGVPSLIGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENA
QVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERI
PSYNLTVSVSDNYGAPPAAEVRARSSVASLVIFVNDINDHPPVFAQQVYRVNLSEEAPPG
SYVSGVSATDGDSGLNANLRYSIISGNKLGWFCISEHSGLVTTGATGGLDRELASEIVLN
ISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYNVSVVENSPAGTELLVLGATDGD
LGDNGTVRFSLQETESDQRLFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSS
VTHINVSLLDMNDNSPVFYPVQYFAHIQENEPGGSYITTVSATDPDLGLNGTVRYSISAG
DRSRFQINAQSGVISTRIALDREEKTAYQLQIVATDGGNLQSPNQAIVTVTVLDTQDNPP
VFSQAAYSFVVFENVALGYHVGSVSASSMDLNSNISYLITTGDQKGMFAINQVTGQLTTA
SVIDREEQSFYQLKVVASGGTVTGDTVVNITVKDLNDNSPHFLQAVESVNVVENWQAGHS
IFQAKAVDPDEGVNGMVLYSLKQNPKNLFSINEKNGNISLLGPLDVHAGSYQIEILASDM
GVPQLSSSVILTVYVYDVNDNPPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEI
AYTISEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVILE
DVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVNAIDKDFGPNGEVRYSFEMVQPDFELHAI
TGEITSTHQFDRESLMRRRGTAVFTFTVIATDQGLPQPLKDQATVHVYMKDINDNAPKFL
KDFYQATISETAANLTQVLRVSASDVDEGKNGLIHYSVIKGNEERQFAIDSTSGQVTLIG
KLDYEATPTYSLVIQAVDSGTISLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIG
ELVSSVTATDSDSGDNADLHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNIT
AKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADI
NGQLSYAIVQQMPRGNHFSIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYA
LKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEVEYEIINGD
IDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFSQ
PKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQ
TAAILDREQGACLYLVDVYAIEKSSAFPRTQKAEVEITLQDINDNPPVFPTDMLDLTVEE
NIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATKRLDRERRSKYS
LLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTTPGSLVAAILATDDDSG
VNGEITYIVNEDDEDGIFFLNPITGVFNLTRILDYETQQYYILTVRAEDGGGQFTTIRVY
FNILDVNDNPPIFSLNSYSTSLMENLPLGSTVLVFNVTDADDGINSQLAYSIASGDSLAQ
FAIDKNGILKVMKALDRESQSFYNLVVQVHDLPQLPASRFTSTAQVSIILLDVNDNPPTF
LSPKLTYIPENTPIDTVVFKAQASDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGE
LDREEVSNYTLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQALYKVEINEDTLTGT
DILQVFAADGDEGTNGQVRYGIVDGNTNQEFRIDSVTGAITVAKPLDREKIATYLLTVQA
ADRGSTPRTDTSTVSIVLLDINDFVPIFELSPYSVNVPENLETLPRTILQVIARDDDQGS
NSKLSYVLLGGNEDQAFTLSASGELRVTQSLDRETKEHFVLVITATDSGSPALTGTGTIN
VIVDDVNDNVPTFGSKMYFTTIPEDAPTGTDVLLVNASDADASTNAVISYSIIGGNSQFT
INPSTGQIITSALLDRETKDNYTLIVVSSDAGSPESLSSSTSVLVTVTDVNDNPPRFQHH
PYVTHIPSPTLPGSFVFAVTVTDADIGPHSELHYSLSGRNSEKFHIDPMRGAIMAAGPLN
GASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKIRVKEQTFMFPENQPPGTLVTTI
TGSSLRGETLSYYIASGNLGNTFQIDQLTGQVTISQPLDFEKIQKYVVWIEARDGGFPPF
SSYEKLDITVLDVNDNSPIFKEDPFVSEILENLSPRKILTVSAVDKDSGPNGQLDYEIVN
GNKENSFSINHATGEIRSIRPLDREKVSHYMLTIKSSDKGSPSQSTSVKVIINILDENDN
APRFSQIFSAHVPENSPLGYIVTRVTTSDEDIGANAVSRYSLMDTSLPFTINPNTGDIII
SRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRPSYYLDCPELAEIGS
KVTQVYATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRH
SFIVTSSDRGNPALLSETTVTVNIVDSNDNAPQFLSDKYFTPVTKNVKVGTKLIKVTAVD
DKDFGLNSEVQYFISNENYLGKFKLDSDTGWISVASSLISDLNQNFLITVTAKDKGNPPL
SSQATVQITVTEENYHTPEFSQSHMSATIPESHSIGTIVRTVSARDRDAAMNGLVRYSIS
AGNEEGIFAINSSTGVLVLAKALDYELCQKHEITIRATDGGWVARTGYCSVTINVIDVND
NSPVFVPDEYFPTVLENAPSGTTVIHLNATDVDSGTNAVIAYSIQSSDSDLFVIDPNTGI
ITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISE
AAPKGTIVGEVFASDRDMGTDGEVHYLIFGNSRKKGFQINKRTGQIYVSGLLDREKEERI
SLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPVFSLNIYSVQISEGVPIGTHVTFVSAF
DSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLTVLAVDSGTPS
ATGSASLLVTLEDINDNGPMLTISEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLL
STGPATNYFSLNTAGVLSTTREIDREQISDLYLSVVTRDSGVPQMSSTGTVHITVIDQND
NPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSILGGTCDLN
SQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRVSVPTVKDFLTNH
YLHFLRIASSQLTGLGTAVQLYGAYEENNRTFLLAAVKRNNNQYVNPSGVATFFESIKEI
LLRQSGVKVESVDHDACTHGPCQNGGSCIRRLAVGSTLKSHESLPVIIMGNEPLQPFLCK
CLPGYAGSWCEIDIDECLPTPCHNGGTCHNLVGGFSCSCPEGFTGRACERDINECLPSPC
KNGAVCQNFPGGFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVDSYYCHCPFGVF
GKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTGERAEFLALE
IAEERLRFSYNLGSGTYKLTTMKKVSDGQFHTVIARRAGMAASLTVDSCSENQEPGYCTV
SNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCVMELAVNGRPLEPSQA
LASQGILDQCPRLEGACTRNSCQHGGTCVDFWSWQQCHCKEGLTGKYCEKSITPDTALSL
EGKGRLDYHMSQNEKREYLLRQSIGGAVLEPFGVNSLEVKFRTRSENGILIHIQESSNYT
TVKVKNGKIHFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGTATVLSIDRIYNRDIT
HPTQDFGGLDVLTISLGGIPPNQAHRDAQTGFDGCIASVLYGGESLPFSGKHSLASISKT
DPSVKIGCRGPNICASNPCWGDLLCINQWYAYKCVPPGDCASHPCQNGGSCEPGLHSGFT
CSCPESHTGRTCETVVACLGVLCPQGKVCKAGSPGGHVCVLSQGPEEASLPLWAVPAIVG
SCATVLALLVLSLILCNQCRGRKAKNPKEKKPKKEKKKKGSENVAFDDPDNIPPYGDDMT
VRKQPEGNPKPDIIERENPYLIYDETDLPHNSETIPSAPLASPEQEIEHYDIDNASSIAP
SDADIVQHYKQFRSHTPKFSIQRHSPLVFARQSPMPL
Download sequence
Identical sequences ENSCPOP00000003279 10141.ENSCPOP00000003279 ENSCPOP00000003279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]