SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003602
Domain Number 1 Region: 319-602
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-69
Family Tandem AAA-ATPase domain 0.0000775
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003602
Sequence length 648
Comment (Cavia porcellus)
Sequence
MSTREAGANASTWVAASRGSSTVCLASDRRPTESPNGRGRRGRRGGRGGGWREPAGLPEA
VAGGHREPPLCFAVKSDLVGAVVETTGRGGSKIKEIQSTTNTKIQIIKGNSEAEVKIFGN
KAMQTKAKTMIDNFVKEQENYSPEYRVDIVAFQPSVGRDVSSNHNVTEYQPLINWDKIRE
DASKWWVRSNSRDHLPPIKKNFYVESATTKAMSQVQVDNWRKENFNITCDDLKDNEKRPI
PNPTCKFEDAFQCYPEVMENIKMAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSY
LMPGFIHLNSQPIAREKRNGPGMLVLTPTRELALQVEAECSKYSYKNLRSVCIYGGGDRS
GQIQDVSKGVDIIIATPGRLNDLQMNNFVCLKSITYLVLDEADKMLDMGFEPQIMKILLD
VRPDRQTIMTSATWPCAVRRLAQSYLKDPMIVYVGTLDLVAVSTVKQDIIITTEEEKRTH
IQTFLENMSPKDKVIVFVSRKAVADHLSSDLILRQISVESLHGNREQSDREKALENFKKG
KVRILIATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDW
RVATELINILERANQSIPEELVSMAERYRANKLKREIGRLQGKPQKFY
Download sequence
Identical sequences ENSCPOP00000003602 ENSCPOP00000003602 10141.ENSCPOP00000003602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]