SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003616
Domain Number 1 Region: 3934-4071
Classification Level Classification E-value
Superfamily CalX-like 1.31e-31
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2959-3087
Classification Level Classification E-value
Superfamily CalX-like 2.09e-29
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2234-2382
Classification Level Classification E-value
Superfamily CalX-like 3.4e-29
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 4 Region: 1722-1811,1839-1899
Classification Level Classification E-value
Superfamily CalX-like 6.93e-29
Family CalX-beta domain 0.00053
Further Details:      
 
Domain Number 5 Region: 2117-2246
Classification Level Classification E-value
Superfamily CalX-like 3.79e-28
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1004-1132
Classification Level Classification E-value
Superfamily CalX-like 3.01e-27
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 7 Region: 2597-2714
Classification Level Classification E-value
Superfamily CalX-like 1.11e-26
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 8 Region: 145-292
Classification Level Classification E-value
Superfamily CalX-like 1.7e-25
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 9 Region: 4266-4410
Classification Level Classification E-value
Superfamily CalX-like 9.02e-25
Family CalX-beta domain 0.00066
Further Details:      
 
Domain Number 10 Region: 1118-1280
Classification Level Classification E-value
Superfamily CalX-like 2.35e-24
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 11 Region: 4665-4801
Classification Level Classification E-value
Superfamily CalX-like 4.19e-23
Family CalX-beta domain 0.0065
Further Details:      
 
Domain Number 12 Region: 1297-1492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-23
Family Pentraxin (pentaxin) 0.094
Further Details:      
 
Domain Number 13 Region: 404-551
Classification Level Classification E-value
Superfamily CalX-like 6.28e-23
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 14 Region: 5005-5134
Classification Level Classification E-value
Superfamily CalX-like 6.67e-22
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 15 Region: 1985-2129
Classification Level Classification E-value
Superfamily CalX-like 1.22e-20
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 16 Region: 3590-3664
Classification Level Classification E-value
Superfamily CalX-like 1.31e-20
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 17 Region: 1879-1988
Classification Level Classification E-value
Superfamily CalX-like 2.75e-20
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 18 Region: 3667-3812
Classification Level Classification E-value
Superfamily CalX-like 4.05e-20
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 19 Region: 786-927
Classification Level Classification E-value
Superfamily CalX-like 4.32e-20
Family CalX-beta domain 0.0062
Further Details:      
 
Domain Number 20 Region: 886-1003
Classification Level Classification E-value
Superfamily CalX-like 1.01e-19
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 21 Region: 5218-5376
Classification Level Classification E-value
Superfamily CalX-like 2.88e-19
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 22 Region: 1584-1712
Classification Level Classification E-value
Superfamily CalX-like 5.1e-19
Family CalX-beta domain 0.004
Further Details:      
 
Domain Number 23 Region: 2821-2956
Classification Level Classification E-value
Superfamily CalX-like 6.8e-19
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 24 Region: 1502-1605
Classification Level Classification E-value
Superfamily CalX-like 6.8e-18
Family CalX-beta domain 0.006
Further Details:      
 
Domain Number 25 Region: 3097-3205
Classification Level Classification E-value
Superfamily CalX-like 8.5e-18
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 26 Region: 2347-2392,2494-2572
Classification Level Classification E-value
Superfamily CalX-like 1.44e-17
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 27 Region: 2702-2836
Classification Level Classification E-value
Superfamily CalX-like 2.22e-17
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 28 Region: 38-157
Classification Level Classification E-value
Superfamily CalX-like 3.92e-17
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 29 Region: 663-783
Classification Level Classification E-value
Superfamily CalX-like 2.35e-16
Family CalX-beta domain 0.0079
Further Details:      
 
Domain Number 30 Region: 4171-4282
Classification Level Classification E-value
Superfamily CalX-like 7.59e-16
Family CalX-beta domain 0.0064
Further Details:      
 
Domain Number 31 Region: 264-399
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000183
Family CalX-beta domain 0.0079
Further Details:      
 
Domain Number 32 Region: 5500-5643
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000301
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 33 Region: 3774-3909
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000615
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 34 Region: 4410-4516
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000157
Family CalX-beta domain 0.0062
Further Details:      
 
Domain Number 35 Region: 4052-4189
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000379
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 36 Region: 4536-4652
Classification Level Classification E-value
Superfamily CalX-like 0.000000000068
Family CalX-beta domain 0.0063
Further Details:      
 
Domain Number 37 Region: 4764-4869
Classification Level Classification E-value
Superfamily CalX-like 0.0000000772
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number 38 Region: 515-629
Classification Level Classification E-value
Superfamily CalX-like 0.0000017
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 39 Region: 5389-5508
Classification Level Classification E-value
Superfamily CalX-like 0.00000419
Family CalX-beta domain 0.021
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000003616
Domain Number - Region: 4891-4986
Classification Level Classification E-value
Superfamily CalX-like 0.00262
Family CalX-beta domain 0.008
Further Details:      
 
Domain Number - Region: 3207-3254
Classification Level Classification E-value
Superfamily CalX-like 0.00746
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number - Region: 3365-3546
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.051
Family Tricorn protease domain 2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003616
Sequence length 6104
Comment (Cavia porcellus)
Sequence
DFFLFLLGMLSTSFLVNLLSAFLIPVIFGETEIRFAGQTQFVVNETSTTVIRLVIQRIGE
PANVTALVSLHGEDTGDFLDTYAAAFIPAGETNRTVYIAVCDDDLPEPDETFTFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGVISFNMPPSVTVRELRGRNESVPVTLIREKGTYGK
VTVTFEVEGGPNPPEEDLSPVSGNITFLPGRATVVYNLTVLDDEVPENDEIFLIQLKSVE
GGAEINISRNSVEIIIKKNDGPVRFFQSIYLVPEEDHILIIPVIRGKDSDGNLIGSDEDE
VSIRYTIITGNSTAHAQQNLDFIDLQANTTIVFPPFIHESHLKFQIIDDATPEIAESFHI
ALLQDSLLGDAVLTGPSVVQVTIKANDKPHGVLSFSSVLFERPVIIDEDTTSRLQEISVV
RNGGTHGNVSVNWVLTRNSSDPSPVIEDIQPSAGVLHFAPGQMLASIPLTVIDDDLPEEA
EAYLLRILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPMENQRIESSRGERYLSLS
LTRLGGTKGNVQMLYSALYIPAGAVDPFRAKDGILNVSRRNSLIFPEHRTQVAKKLPIRN
DAFLQNGAHFLVQLDTVVLVNIFPPIPPISPRFGKIRNISLAVTPAIANGEIGFISNLPI
ILHEPEDSAAEVVCIPLHRDGTDGQATVYWSLKPSGFNSQAVTMDDIGPFNGSVVFLSGQ
SDTTINITVKGDDVPEMNETVTLSLDRVNTENEVLKSGYTSRDLIILENDDPGGVFEFSP
ASRGPYLIQEGESVELHITRSRGALVKQFLYYRVEPRDSNEFYGNTGILEFKSGEREIVI
TLLSRLDGVPELDEHYWVVLSSHGERESKLGSATVVNITILKNDDPHGVIEFVADDLTVT
INESKGDDIYNAVYGVIRNRGNFGDVSVLWVVSPDFTQDVFPVQGTVFFGDQEFSKNITI
YSLPDEIPEEMEEFTIMLLNATGGAKVGNKTTATLRISRNDDPIYFAEPRVVRVQEGDTA
NFTVLRNGSVDVTCSVQYATLDGKATAKEGDFVPTEGETLVFDVGSREQSVSVHVNEDGI
PETEEPFYIILFNSTGDTVVYQYGIATVIIEANDDPNGIFSLEPIDKTVEEGKTNAFWIL
RHRGCFGNVSVGWQLFQNDSALQPGQEFYETSGTIQFMDGEGMKPVILHAFPDSIPEFNE
FFVLKLINISGGSPGPGGQLAETNLQVTVMIPFNDDPFGIFILDPECLEREMAEDVLSED
DMSYITNFTILRQQGVFGDVRVGWEILSSAFPAGLPPVVDFLLVGNFPNTVQLQPHMRRH
HSGTDALYFSGLEGAFGTVNPKYHPSRNNTIVNFTFSAWVMPNGRTNGFVIAKDDGNGSI
YYGVKIQTNESHVALSLHYKTLGSNATYIAKTTVMKYLEEGVWLHLLIILDDGIIEFYLD
GNAMPRGIKSLKGEAITDGPGVLRIGAGINGHDRFTGVMQDVRAYDRKLTLEEIYELHTM
PAKNDLHPISGYLEFRQGETNKSFIVSARDDNEEEGEELFFLKLVSVYGGAHISEENTTA
KLIIQKSDNANGLFGFTGACIPEIAEEGSTISCVVERTRGALDYVRVFYTISQIESEGIN
YLVDDFANVSGAITFLPWQRSEVLNIYVLDDDIPELNEYFRVTLVSAVPGDGKLGSTPTS
GASIDPEKETTDITIKASDHPYGLLQFSTEPPPRPEDPMSLPASSEPHLTVQEEDGEVQL
LVVRAQGLLGRVTAEFRTVSLTAFSPEDYQSAAGTLEFQPGERYKYIFVNITDNSIPELE
KSFKVELLNLEGGVAEVLRVDGSGSGDGDMEPFFPAIHRRASLGVASQILVTIAASDHAH
GLFEFSPESLFLNGTEPEDGHSTVLLKVIRSHGALSQVTLHWSIDSDPDGDLAFTSGNVT
FEVGQKHAHITVEILPDEDPELDKAFSVSILNVSRGTLGVHTNATLIVLASDDPYGVFIF
SAENRPVIVEEAPQNVTLSIIRLKGLLGKVRVSYTTVDDMETPSYFPPNLARATQGQDYA
SASGFTLFRANQSQATITISILDDDEPEKSESVFIELLDSVLMEKVQNRPIPDSPRLGPQ
VETIAHIIILANDDAFGILQLSASVVRVAENHVGPIINVTRIGGAFADVSVKFKAVPVTA
IAGEDYSIASSDVVLLEGETSKAVPVYIINDIYPELEETFLIQLLNETTGGARLGTLTEA
VITIEASDDPYGLFGFQITKFIVEEPEFNSVKVNLPIIRNSGTLGTVTVQWVATINGQLA
TGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTEASGGGTIGLDHMANII
IPANDNPYGTVAFVRSVYRVQEPLERSSCANITVRRSGGRFGQLLLLYSTSDIDVVAFAV
EEGQDLLSYYESPVQGVPDPLWRTWVNISAVGEPQDTCAALCLREQACSAFSFFSAAKGP
QCFWITSWISPTINSSDFWTYRKNTTRVASLFSGQAVAGSDYEPVTRQWAIMLEGDEFAN
LTVSILPDELPEMDESFLISLLEVHLVNITASFKNQPTIGQPNTSTVVIALNGDAFGVFV
IYSMAPNASEDGLFVEVQEQPQTLVELVILRTGGSLGQVTVEWRVVGGTATEGLDFTGAG
DILTFAEGETKKTAILTILDDSEPEDDESIIVSLVHTEGGSRILPSSDTVRVNILVNDNV
AGVLSFQMASRSVIGHEGEILQFHVIRTPPGRGNVTVDWKIIGQNLELNFANLTGQLFFH
EGTLNKTIFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGMALLDTQGYAAVLTVEASDE
PHGVLNFALSSRFVLLQEADMTIQLFINREFGSLGAVNVTYATVPGTLSLRNQTEGNLAE
PGADFIPAVGFLVLEEGQTAAAINITILEDAIPELKEYFLVNLTSVELIMAPVTSFPPRL
DSEGLTAQIIIDASDGARGVVEWQRSSFEVSESHGSVTLAAQRGREALGQVSLFVYAQNV
EAQLGQDYIFTPMILHFADGERYKNVDIVILDDDIPEGDEKFQLILTNPSPGLELGENTI
AVITILANDDGPGVLSFNNSLHFLLREPAAGHAQESVAVLHVVREPAHGLFGTVTVQFVV
TGVNSSEESRDLMPSSGYIVLEAGVRVKALHIAAILDTEPEMDEHFVCTLFNPTGGARLG
ERVQTLITVLQNQAPLGLFSISAVENRATSVNIEEANRAVYLNVSRMNGINLAVSVQWET
VSETAFGMRGMDVVFSIVQSFLNESATGWCFFTLEDSVYGVMLRKSSFTLYRWQGIFIPL
QDVNIENPKVCEAFHIDHSPYVVITHKERNGEKPSANSVYTLTSGFKLLLVQTIITLESS
QVRYFTADNQDYLIVASQRNDSELTQVFRWNQGSFVLHQKLPVRGVLAVALFSRGGSEFL
AISQADPRLAALIFRWSGGAFVNSQEVPVTGAARLEALSAGNDVYLIVAKDLSLGNENSV
DIFVWETGQPSFRYFQSLDVATVKGIHSFTPASGIAHVLLTGPEASALYCWDSGRNLFSF
LLEAPPAQAAASVTVRSLNSSKSLLWVADASEAHLLELSSTYFIRTCHTSSGELVFGPGD
REAIIAVNILDDSVPEEEESFRVQLRNPTGGAEIGSQGSVRITILSNDDAYGVVAFAQNS
LYKQVEEMEQDSLVTLNVERLKGTYGRVTVAWAADGSVGDIFPTSGVISFAEGQVLSTIT
LTILADDTPELSEVVTVTLTNITTEGVGDPAKGATIDLQRHKSLITTLASDYPYGLVGWH
TGSLFTRVVEPTENNTILPLKIVRDKGLFGDIAIHLIAKPNFLLHINNQATENEDYVLQE
TIIIMKENVKETHAKVAILPDDAPELEEGFVVTITEVTLVNPDFPAEQPRVRRPGREMAE
IVIEENDDPRGIFKFHITRDLSSGAVTAHELPPPLGVLQVPVVRLAGSFGPASVHWRASP
GSAGAQDFTPSHGTLEFADGQVTAVIEITIIDDAEHEAAEMFSLALTSVSGGGALGDDVL
LTIVIPQNDSPFGVFGFEEQTVMVDEPLLSDDPDSYVTLRVVRSLGGRGAVQLQWMLEDK
AKDVLSPLKGILHFDEMESQKTIVLNTLQDATWDKDRRFTIQLTAPAEVEISPVKGRASI
IMRREKTASGEVGVALSSRHILIGEPLATYNGTAVISLIRGPALWGEVTVWWRIFPPSVG
EFAETSGKLTMQEGQSTAIVVIQALNDDIPEEKRVYEFQLTDVSEGAGLSTSSHMASITM
VASDAPYGHFAFSQEQLWVLEEVQKINVTVARAGGCLGLVRLWFQTAGGTADAGVDFIPA
AGQLLFGVGEMAKELQVEILDDDHPEGPEDFSLAIVKVELQGRGYDFTIQENGLQIDQPP
EIGNISTVQIIIMQNDNAEGIIEFDPAYTAFEVEEDVGTFSIPVRRLRGTHGRVTAEFVA
QSPALTPGGVDFTLHGASVTFQHGQNLSFIHVSVTAGGESEPPAEPLQILLTAATGGALL
GRHLVSRVTVAARSRPPSGLVRFLNDSAISLPNPDSPEPVALVLERTGGFLGEIQVDWVI
VGPNSEEALPAQNPDFAEPVGGSFSFADGEGGRRTILLTIYPHEDTEVEETFEVKLQLVR
GEARLDSRARAVTLTIQKFGDPNGVVSLISESTSGKTYSEPLAGEGPLVITFFVKRVKGT
FGEITVYWELSSEFDITGDFLSTNGVFTIASGETSASFDVHLLPDDTPELEEAYMVRLVS
VEGGAELDLDSSVAWFSVSANDDPHGVFALYSERQSILIGQNLTRSIQINITRLAGTFGN
VAVKLQILSKHEEQPVAAENAERQLVFEDGAWHKVDTVPIASQVFLSLGSNFTVQLVSVT
LVSGQFNSRPRILQEAKSAVLPVPEIAANSQVGFESTAVRLTDITGGTSQVTISRSGTYG
ALAVTWTTGYGPGWEIPESVVIGNMTPVLGSLAFAHGEGRKQVVLCVVPRPGRTEAFVLH
LAGVRSSAAGGARLRSGFTTAEIEPTGIFQFSPSSRAIRVSEAAQLVQLQVQRLYGFQGD
LITISYQTATGSAKPGEDFELIQSGEMFFYKFQTETDFEITIINDQVPETEETFYINLTS
IATRGLEKQDANWRPRLNLDFSVAVVTILDDDHPASTYASVPTTDVAVAVNTTLIPINTD
TTTHPDTGRTAATPQATEMVVIVTEATGTSATPGKPVTLYGTSTLLDKPDTANGSIHGTF
SLGPAIVYVEEETRNGTFSTAEILVRRTGGFAGNVSVKVRTFGERSAQKEPSAFPFQDAH
GLLANRSWAAEEEDFEEQVLTLTFLEGEREQRVAIPIVDDEEPEEQEFFYVFLTDARGGA
QIIKGKDEAGFAAFAVVIIEGSDLHNGIVGFSEHSQGEMELGAGSEERRLRLVVTRQPNR
AFEDVQVHWRATLNESAVILQKEGVNLEEEILSVSGTTTCAAGQTQCFISLELNPEKMPP
VETHYFFVELYGVTAGAVINSSARFARIKILQGHGAQSLVYFAAGSRLAVAHKKATLLSL
QVARDAGTRLTVSVNFSTQELGRAEMIGRTLLSPAVSGKDFERTEGMLLFEPGQRNTVLD
VNLMPDTRPSSTFPKRFQIVLFNAKGGARIDEAYGTANVTLVSDATSQALWELAEELQQP
LEEDTLRRVLHGISVKVATESTDEQLSVSMHLIEKITVEGRNQAFSIESRTLLYEVLCAL
VNPKRKDTRGFSHFADVTENFAFSLLTDVPCGSAAEKSKTILDSCPYLSILALHWDPQKI
NGHKFEGKEGDYIQIPERLLDAPDAKTVPGESACKLVQFTEYSSQQWFVTANSLPALKSK
VLSLSVKGQHSQVLANNNEVLYRIYAAEPRIVPQTSLCLLWNQATESWWSDSPLCRVVGD
AEDYVDCACAHLSTYAAYAQMHNSSAYNEAFFSSGFICMSGLGLAVVSHVFCARCSLLAA
KLLTHMMTASLGTQIAFLVSAYASPRLSEEGCSAVAAITHYLYLCQFSWMLVQAVNFWYV
LVMNDEHAERRHLLLLLLGWGLPALAVIVLIVVLRGVHHQSMPQIYGLVHGDLCCIPNVY
AALFSAGLAPLACLVVIFVVFVHAYQVKLQWAAYDDVFRGRTNA
Download sequence
Identical sequences 10141.ENSCPOP00000003616 ENSCPOP00000003616 ENSCPOP00000003616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]