SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000003881 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000003881
Domain Number 1 Region: 172-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-16
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 111-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 232-295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 481-538
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 5 Region: 50-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000105
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 424-483
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000612
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 303-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000985
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 8 Region: 385-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000528
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000003881
Sequence length 605
Comment (Cavia porcellus)
Sequence
MHPTRAPNGTLSKKGALRAWAFSRLCGVPHPTLFQMALVTSLLATVLGRCGPPPVLFFAT
PAKELNQTEFTTNTVLKYTCRPGYIRIHSDQTLTCKVNGQWRYEVFCSKKQCRNPGDLPH
GTIEVKTDLFLGSKIEFSCSEGFNLVGPTTSVCEIHDKGVDWSVPFPICEIIKCRSPPDI
SNGKHSGAVEDLYTYGSSVTYSCDPSYSLLGNPSISCTVVNKTVGVWSPSPPVCKKVICR
QPIVQYANIISGFGPIYTFKDTIMFSCQKGFVLKGSSLIRCEADNNWNPSPPVCEPNSCV
DIPDIPDAYWDSYRRPRKGELYSPGTVFKYSCHSGYVPATHESTTVTCQSDFKWSPFRGC
KKVCCPAPEVNNGRSMRAADSYSTDCPFSYNNIFQYRCDSDRQYYTSTCQADGTWKPRVF
CGQACHVPPEIAHGRYRKEGGYLSALSYVYECDDGYTLVGQNTITCKNSLLSSEAPQCKA
QCLKPKIENGKLSVDKPQYIEPENVTIHCDSGFKLEGSPSITCSEKGTWHPGVPKCEWEV
PENCEQVIVGKKLMKCLSNPDEAQMALQLYKLSLEAELLRLQIVKKHVLGLNERQEGSLA
IFNDD
Download sequence
Identical sequences ENSCPOP00000003881 ENSCPOP00000003881 10141.ENSCPOP00000003881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]