SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004383
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000054
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004383
Sequence length 612
Comment (Cavia porcellus)
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAASGTEVTSSGGSPGAAPAPPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAAEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAVSQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KSEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYSQPSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPVST
GQSPMSGPFIPAAPIKTALPAGPQPQPQPPLPSQPQSQKRRFTEELPDERESGLLGYQHG
PIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGMKTETDERNGSG
TLPGSHDYPAKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQP
RAKQQMPFWMAP
Download sequence
Identical sequences H0V451
10141.ENSCPOP00000004383 ENSCPOP00000004383 XP_003475668.1.53824 ENSCPOP00000004383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]