SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004522
Domain Number 1 Region: 270-348
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000813
Further Details:      
 
Domain Number 2 Region: 38-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000004522
Domain Number - Region: 138-172
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000246
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004522
Sequence length 355
Comment (Cavia porcellus)
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELREVKAFLFSA
IFHSKCFSFIHIGVCECMNCNYSKYCTFRDLMAYDRRGRPGDRYDGMVGFSADETWDSAI
DTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQR
IKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
Download sequence
Identical sequences ENSCPOP00000004522 10141.ENSCPOP00000004522 ENSCPOP00000004522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]