SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004540
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.00000000432
Family HMG-box 0.0051
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000004540
Domain Number - Region: 167-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00356
Family Calponin-homology domain, CH-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004540
Sequence length 411
Comment (Cavia porcellus)
Sequence
MPNRRASRNAYYFFVQERMPELRRRGLPVTRVADAIPHCSAEWALLREEEKEKYSEMARE
WRAAQGKESGSSEMQKLASTPLRRPGMFIPKPSVLPPDMSSLSLKSDQALLGGVFYFLNI
YSHGELPPHCEQRFLPCEIGCVRYSLQEGIMAVFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFEFGHDQATVLQNLYKFIHPNPGNWPPVYCKSDDRARVNWCLKRMARELEISQDI
ELLTVEDLVIGIYQEKFLKEPSKTWVRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTGAHVPLQDYEASNSVTPKMVVLDAGRYQNQRVESPRFPHFS
CSNQEQRLNTSCGDYPPGVKIPGPNSRVRGRGITRLLESISSSSSSIHKFS
Download sequence
Identical sequences ENSCPOP00000004540 ENSCPOP00000004540 10141.ENSCPOP00000004540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]