SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004591
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.3e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 201-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.11e-21
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004591
Sequence length 281
Comment (Cavia porcellus)
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNIQTSGRLSNVAP
PCILRKNPPSARNGGHETDTQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEH
ESENSPVIAGIISILYATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences H0V4P0
10141.ENSCPOP00000004591 XP_003472944.1.53824 ENSCPOP00000004591 ENSCPOP00000004591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]