SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004624
Domain Number 1 Region: 89-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000038
Further Details:      
 
Domain Number 2 Region: 189-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 3 Region: 375-448
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.55e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 
Domain Number 4 Region: 280-354
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.31e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004624
Sequence length 626
Comment (Cavia porcellus)
Sequence
MSDYSTGGPPPGMRAVCAGGGGEGGGLFWSREDCRCLEIAAKIGGDAATTVNNSTPDFGF
GGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGE
QINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHD
NANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRI
IGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMI
KKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRVGGPGASGPPG
PPGGPGMPPWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDP
NFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGA
PPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPNKAAAAAADPNAAWAAYYSHYYQRRTTP
RPGRSTTRRSVRLGRLAGQDDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYY
RQQAAYYGQSPAQGAGPSQGPAPPSP
Download sequence
Identical sequences 10141.ENSCPOP00000004624 ENSCPOP00000004624 ENSCPOP00000004624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]