SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004879
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-42
Family Galectin (animal S-lectin) 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004879
Sequence length 131
Comment (Cavia porcellus)
Sequence
MAQVSFEISNMEMKLGETLKLKGQIQDNVDSFAINLGRGPDELSLHFNPRFNESVIVCNS
KEAGCWGQEHRDDHMCFSQGADVKFTVTFQSEEFKVTLPDGYQLTFPNRLDHSHLSYLSV
RGLHISAFKLK
Download sequence
Identical sequences ENSCPOP00000004879 ENSCPOP00000004879 10141.ENSCPOP00000004879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]