SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000004886 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000004886
Domain Number 1 Region: 53-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.63e-28
Family Thioltransferase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000004886
Sequence length 156
Comment (Cavia porcellus)
Sequence
MSWRSALLAGSRLVGRRGVSAGQLRGAVGAGGTAASGMGNSTSSLGESANTPVKEIQEII
SNNCVVIFSKTSCFYCTTAKKIFHDMNVNYKVVELDMLEYGSQFQDALYKMTGERTVPRI
FVNGIFIGGAIDTYKLHEEGKLLPLVRQCYKRKEFQ
Download sequence
Identical sequences ENSCPOP00000004886 10141.ENSCPOP00000004886 ENSCPOP00000004886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]