SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000005053
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 7.36e-21
Family S100 proteins 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005053
Sequence length 101
Comment (Cavia porcellus)
Sequence
MAANLEQALSTVLVVFQKYSSHSGDKHKLCQAELKELLQKELPTWTPTEFRECDYEKLMS
ALDSNKDCEVDFEEYVHSLARICLFCHDYFKDCAPDPPCPQ
Download sequence
Identical sequences A0A286XHB4
10141.ENSCPOP00000005053 XP_003475597.1.53824 ENSCPOP00000005053 ENSCPOP00000005053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]