SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000005097
Domain Number 1 Region: 5-122,154-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-74
Family Calponin-homology domain, CH-domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 6153-6308
Classification Level Classification E-value
Superfamily Spectrin repeat 2.12e-18
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 3 Region: 5826-5979
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 4 Region: 5974-6099
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 4895-5013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000036
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 6580-6725
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000391
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 7 Region: 5024-5128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 8 Region: 5721-5875
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000037
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 9 Region: 5091-5198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000138
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 10 Region: 5522-5653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000115
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 11 Region: 3694-3841
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000675
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 12 Region: 5266-5350
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000132
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 2204-2326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000202
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 14 Region: 2077-2195
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000104
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 15 Region: 6496-6606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000164
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 3269-3421
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000259
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 2668-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000273
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 18 Region: 2757-2909
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000456
Family Spectrin repeat 0.017
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000005097
Domain Number - Region: 1759-1917
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00044
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 1505-1627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000576
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 4548-4681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00103
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1412-1518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0013
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 1591-1700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00432
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 2479-2597
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00489
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 2020-2110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00738
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 554-637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0518
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005097
Sequence length 6841
Comment (Cavia porcellus)
Sequence
FSLVAEQEDTQKKTFTCWINSQLAKHTPPSVISDLFTDIRKGHVLLDLLEVLSGQQLPRD
KGSNTFQCRINIEHALTFLKNQSIKLINIHVTDIVEGNPSIILGLIWTIILHFHIEELTQ
TLSGSYSQPPVDDVSVPDSPAASSPPAKKCSTAQARWQLSAKKALLVWAQECCASHESIS
VTDFKSSWRNGLAFLAVIHALRPDLIDMKCVKHKSNKDNLKEAFTIAERELKIPRLLEPE
DVDTVNPDEKSIMMYVAQFLQYSKNAPVIRSKAQSKVEDAVAWLTLQEEKLQQVQKDTAN
ETYYNKYQRLLSFVESLNDFLDLLSLKGNAQELSEDQRLLTEGWNGLHCQINAWKTKLED
ALPPPLRDTQACLREVEELAEEALSASQDSSDPVALTQEKMTVFKNLMDRFDYHSNILLT
FENKDEKDLPLVPPDKLEEMRRRLNNILEKKFILLLEFHYHKRSVLGLLDEVKSKLDVWN
IKYGNRESVELLLEDWHKFIEEKEFLTQLEASFQRCGEIYKNLAGEYETINEQYMIMEQN
VCMYRKNIENVKSALQKVLACWATYLENLRSLKAYFEDTKKEQVTEVPFEMLSQWNADHT
TLNEVGHLLIEVSNDEVGSSISKELRRLNKRWRKFITKTPLEMKLPRDEPIPEDSGTSLP
FKQEKLPVDFSMDTAVEAPENHNQNVKAMEDYERENEESPEQLKVSEEVEKLTGQVEIWE
AETRSVLDLLRHQDAMDSSLEEALQHLSARGSMYEELLARTEDALQMDVQNISGPESLQH
VLTGGLQAKIQEANEKIQITMVKLVTALKNSADACPDSDSKQRMEETQQEFELSVRKAEQ
LLAQRESQSELISKYKEALKIHNANSLVKYLKAIEELKPSVSEAAKLSLEEKSRVARAKW
ESLHHEISLYIQQLKIDIEKGKLNDTIAKLEKQINKEKKLIRRGKSKGLIKEHEACFGTD
GIVGQLDHHTGILRELSEELDSQERQQEVKRALRDYEQKIERLLKSAAEVLTMLKAPAGG
SSKVQGTMTATENGGKDSHSKGLIAKSDNQPSAAKASEAMEPIKNFNQALELKPQGEENV
EKNGKDDNASVNKLQERYDTQKEILELHLQNNKFRITSDFSDEKEWRSACLQDKLKDLQL
LKKETDAYWKEFEIASLTLESLVSDTEKPIIVKARDTLKGKENDFQMPLKTRLESLELAL
QVALPVEESLLLCDLDLALREVAVQEFHLMDADSVYQNLRNIQDSIAKQIAICHDLEEPG
NSVLKGLHPTDIGATQNIVLKCRTQLEQTSHRMQMAKDVLAALEDFLSSVAAVKLSKELF
TDPSAPDAQGAPGTTVTKRDMEEEIRLMSNKARQLDKRLKKLGISFKDAERGGDSTCEKL
VDAVSTELLDTQGPGTRQELAEENKLLEACSSKNNELFKNIQDVQKQMSEIGLKDPTVPA
VKHRKKSLIKLEKDLDGYAAEKKHLEEMASSLPQFKDGREKILNEQCQNTVLLWDSTKTA
VTECLEQCGRVLELLKQYQNFKSVLTTLIQKEETIISQQASYMGKENLRKRMAEIEIVKE
EFNEHLEVVDKINQICKNLQFHLNKMKTFEEPPFEKEANVIVDRWLDINEKTEEYYENLG
RALALWDKLFNLKNFIDEWTEETLQKMGSHLLTEEDRERLKEELRMHEKQTSEFSKRVAE
IQFLLQSSEKPLELQVMESSVWNKMEHVKKCVTGEASSCALGGSQAELREDLDQAKTQIG
MTESLLKALSPSDSLEIFTKLEEIQQQILQQKHSMIILENQIGCLTPELSELKKQYESVS
DLFNTKKSALQDHFSALLNDQCKNFNDWFSNIEMNLKDCFEPSETKKSVQHKLQKLSEFL
SLEGRGGKIQQVETVLQHVKKHLPKARVKELSSWLVSQEFQLEKMESICQARARELDSDL
QQLLRLEDDCGNLSKWLINQEEKWKETGESGEKAELFRQALARKREQFESVAQLSSFLKE
RGLEEEEVIMQSTHLMGRYQTFLRQLGRTEEEPQLPSEEGQSFDDLAHGVIHWIKEIKES
LMALNSSEGKMPLEERIQKIKEIILLKPEGDARIQAIMRQAQGCEALAGQVQEMVADIRE
QWDSTQHLASTYLSHQEKLLQEGEKYLQSKEDLRLMLTELRKKQEAGFALQHGLQEKKAQ
LKIYKKFLQKAQDLTSLLEELKSQGNYLLECTKNPSFSEEPWLEIKHLHESLLQQLQDSV
QTLEGHVQEHHSYQVCVTDLNTTLDSFSREFVSFSDTPVNQTAIEDKLQKLQELESRLRL
QDGTLKKILALAKSIKPNTSSVGQKIIKDDIKSLKHKQKDLENRIALAKRETENCLNSLL
KSKRSAEKQENSAALNGEARATSDALESTQGSTAEGKSEGDWDINKNSAVEMVLSKQLSL
SVQESMKSIDDEQKVNELRNQPLELDTLLRNEQLRAIEELYAQLEAKKEAIDSLAQSKCL
HDSETSALGPHKARCSPHHLDSLLQALTALKKNKESQYSLLQDFQERLAALESSMTASLA
GEGSLKVGALDSETYLNKIKKFLELIEKEKGSLVDLQVQWETLSEHMTDMDKKLLGSQMK
RLERGWEHLAHLAQKKYSQHTAECDEFASLRSKIRDTEISLLGLKSPEDQDGSQSIVTLA
AELQAARRGFTAVRSRAEVQMKRLWGEKEKKILEDAIQNLKKQFEALEPLNLEVESQIKK
CDLKSKMKETLLWIRNLLSELTLPISLLPDNILFQIRKCKVMHDSILDKQQAMESLAEEV
LAEVPNLTTPERDNVNSILQDLQNQYQMLVLQSTQRSQQLEFKLEERSKLFEMMKEAQLT
LEGHEALLVPKTEAPPTEAELEHHHATLRASQKGLQEVESLISARLRELTDASEDLSVFE
RLFLDNHLNNLKTRVSRIQRCIQSKCNEVEHKISSYREFHERESMLQKEVDMVQHNKLLL
HLETNQDAKEEFQHFKERLAGVRRSILDVLKLREVFDHIGLNWDGSQLDQLQTQVIKQLN
IFMAEHGKYQASLSQMRAMNLQIKKKAELVLKSPPPLPENDLLNAQILIEKIDKAKCLHN
DIIKKLSENKAFDDSFKEKEIAQLQLVTEENKKLHKLLQTLVLEFQPKEVDEKHFQDKLE
NSLHVLHGIKSQLEQPLLINLDIDHMQNEKDNCEAFQDQVHAEMYSIKAMTPPENQRGEN
SSETSDTEAKLHDLEDLQMQLSKSIDLRTNVLDSAYENFTCYSEAVSRAMEILGSLEAMF
VSCRVDLHNPEEALTRSGWKQEELESIITVIEDLTEKLGSVSSPEAKMQLEHTLQDLLSK
RLTLQEAAKAEQTVACRCLEDYKGYRSSKEEICAGLQRAETALGLAMVLLPASYKEALER
LEQSKALVSELLSTKEELMQLRRVAGRLSGCCTQGDGVSTLRAASALWDRWLCVLEAAQE
WAMWSEDLKQDWKFISEEVEREAIILENLQEELPEMSKMKEAASTEALSEALASLCQYEE
SVEEQELLLRLLLQRMQGIRNVLEGSDATGMVPAHQEIAAMRERCCRLLQKVQNNKELIQ
TEIQERLNFTKEIIALKMLFQQSTNAFQNMASEGRPQRAEQLEELQSFVEKGKLTFGNIM
EKLRIKYSEMYTIVPAEVESQMEECRKVLEDIDEKISGEGLRSSPSCVTGRKIEEINSGL
QQVEQMLQQKSKNIEKAQDIQKKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDKL
MVPFQKYQQVSQRAEARTSQLNKATVKMEEYSDLLRSTEAWIENTSRLLVSPAHCDSSKT
LSQHASALQMALEDSEQKHNLLHSVFTDLEDLSIIFETDDLVQSIQELSSQVTALQQQIV
ESLPHIQRVADDVVAIESEVKSMEKKVSKIKTILLSKEIFDFSPEEHLKHGEVILGNLRP
MKKTIAEIVSYQVELQLPQPEVNPLPVFQRTNQLLQDVKLLENVTQEQNELLKIVIKQTN
ECDEEIENLKQILSDYAAEFSLGHTSPDQATDLPAVQEEIEAVEKQVLRLNQKKEDLLVD
LKAAILTLHEHLKQDQQEAERAGQSATTSEDRAAEREALEWKRDRTGSMSFLPAVEEEAE
ESPVQSEDGCEEARPSAGSQPFLWEQDEDLEGNGAASSSATVIQEAERKISTCDRSMMQI
LAPDSPVTEQDPEFSAGLSQTGDAATLPTEAAALDFAVEQGPLRPTVEPAEPRPAEVLHV
CQTQVAKLELWLQQASVAFEPETLNTDMQQVVEQELVGCQAMLTEIEQKVASLLETCKDQ
CLGDSGTIQHEAEVLSLKLRTVKCNLEKVQMMLQEKYSEDQQFPTILKKPSEHLKFLRPV
HLSELEFIVTERPQFSRLKDVPQPQVLELKPMEQRDLIKFIEFNAKKTWPQDCQQDGSTT
QESSTRGKASDSENEAPDSTSASQGQRSSDKWQYLLHKLASRRRLPPPQVVEPQITTGVG
VLPSVRVCSFKYPTIEELKTYTTLLEDLRQEANDLQTQENVTAEPYVSLDKKLFDLCLTL
SQCLGSVEELLQTPGLLREDTHSQQAHCEELALELKKLYLALGDKKDDLLKAVTWPGKNA
SLFLDCFNDLQLYLEHVQAKAAWRSKSLKAGLDYTHSYQNEIKRLYDHLIKSKTALQQSL
NEISGQSIGDQLQKADAYTAELQKSENRVAKLRDEGERLGFPSTVLQEVHKLEDILDSMW
GILRARYLELSSPFNSESQLDALLQGLGELVSIGQEKLVQGHLQQAKSKAALQAQLQSHK
VFFQKLVADMLLIQTYSAKMFPSLLQKREAFWAEQVSEIKSLEDKAQQCGVKLQSLLQKW
EEFDENYASLEKDLEILVSTFPSVNLVEETEERLMERISLYQQIKRNIEGKHARLYQTLS
EGRQLAACVSCPELEGQIARLEEQGLALSRKTDHELHRLQTLLKHLLSYNRDSDELTKWL
ESSQQTLNYWKEQSLNVSQDLDTIRSNIKKFFDFSKEVDEKSSLKSAVVSTGNQLLHLKE
ADAATLRAALAQFEQKWTLLITQLPDIQEKLHQLQMEKLPSRKAITEMISWMDNVEHQMA
AEDSVCAPSSASQVKRLLRKLKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEF
AEHLGEMNRQWHRVHGTLNGKIQHLEQLLESITEHENKIQILNNWLEAQEERLKTSEKPA
SVLSIEKLLLDCQDIENQLAIKSKALEELRQSHLTLESGATPWLEDPASGVDGFFQKRSS
VLDEVARLRASVQSVLAAQKTCEKLYEEVCGTVVRFRYRAEHSKPETPSLEALASQVQTL
QCLQDEAESSEGNWEKLQEVTAKLKESCPSVAEIIEEKCQHTRARWTQVNQDLADELQRA
SGLLQLWKAYHSAHTEVTAKLEQQEAKFQQLSKINTSGNNLAETLPLALQDIQELQHHVQ
KTKEAVLQNSTLLERLPQPAETSVPELLSGQQHALQRAAYLEKMLLMKASEFEFVLSQFK
EFGDQLESLQDLIIREEENLDKLYQLEKEENPDSFLNHVLALTAQAPAIERLNEVSLRLP
LSDVAVKTLQQVNRQWVRATATALDRCSELQGIGLNEKFLRYCEKWVLLLERSEEALREN
VANSLPALREQQKTLEMLEAEVSISQPIADSYITQSLQLLDTTEIEKRPEFVLEFSKLVD
RWQSVGQGIWQRKCEVTGRVQQQQSFSTATEDLLRFLGATSLLLSAVKGQDRYSLLQTRE
LTQELKNKEIHFQRQQTTYALAVEVGEKLLNTLDQETQESVDRRISQLRDSWDDTKRQLG
LLLKQLQSTGETWDQCERKIKELKSRLQVLKAQSKNPLPELHEDLQKEKELIKDLEKSLA
NWSQNLKELHTMKADLAAHVLAEDTMALKEQIEHLHRQWEDLCLRVAARKQEIEDRLSSW
IVFNEKNKELCAWLVQMENKVLQTADISIEEMIEKLQKDCMEEINLFSENKLQFKQMGDQ
LIKASNTARAAEINDKLHKINDRWQHLFDVIGSRVKKLKETFAFIQQLDGNMSNLRTWLA
RIESELSKPVVYEVCDDQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACAN
ETECDSIQQTTRSLDRRWRNICAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKSAERTA
ACPNSSEVLYTSAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASRLKQMV
HEGNQRWDNLQRRVTAVLRRLRHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDA
DDKMRQLDGFQQEITLNTNKIDQLIVFGEQLIQKSEPLDAALIEDELEELHRYCQEVFGR
VSRFHRRLTARTPGLEEEKEASENETDMEDPREIQADAWRKRGESEEPTSPQSLCHLMPP
TLGHERSGCETPVSVDSIPLEWDHTGDVGGSSSHEEDEEGPYYSAVSGKSISDSHSWHVP
DSPSPAKHRYKQMEEDRSEPPIPSDASTPYKQPYVKLLQPRIHGGKEGARVLNGSHQQEE
EQQLASAAGQQSGAFDTWELIQAQELHSKHRIKQNMQQLNSVISDITAWLEKTEAELEAL
KMAKPPSDIQELELRVKRLQEIVKAFDTYKTLMVSVNVSAKESLPSESAEASELHHRLCQ
LNLHWETAQGKMDSWRETLRQSLLQCQDFHQRSQSLLLWLASAEEQRQKALVTDPKADHQ
DLLRCQKQLMQLEKELAECQPHVNSLHELSTSLLVKGNGEDYIEAEEKVHVIKKKLQQLR
EQVARDLLSLQRSQNPDPALPDFDEVDSGDQPPAASAPAPQAKQFLAEGITEDEDNSDGR
VSGPAGPSSTKPRRSFLSRVIRAALPCLLPASEEDYSCTQANNFARSFYPMLSYTTSTTP
T
Download sequence
Identical sequences ENSCPOP00000005097 10141.ENSCPOP00000005097 ENSCPOP00000005097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]