SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005319 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000005319
Domain Number 1 Region: 2448-2815
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-98
Family Regulator of chromosome condensation RCC1 0.004
Further Details:      
 
Domain Number 2 Region: 2943-3292
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.83e-90
Family Hect, E3 ligase catalytic domain 0.0000551
Further Details:      
 
Domain Number 3 Region: 482-664
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-34
Family SPRY domain 0.0096
Further Details:      
 
Domain Number 4 Region: 1876-1983,2039-2159,2189-2262
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.36e-34
Family WD40-repeat 0.01
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000005319
Domain Number - Region: 200-322,351-447
Classification Level Classification E-value
Superfamily ARM repeat 0.00365
Family HspBP1 domain 0.052
Further Details:      
 
Domain Number - Region: 1198-1260
Classification Level Classification E-value
Superfamily UBA-like 0.00401
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005319
Sequence length 3316
Comment (Cavia porcellus)
Sequence
GLMHSQLESLSDSWVHLKHSRDWLYNSSYSFESDFDLTKSLGVHTLIENVGSFVSGDVGN
TPGFKEPEDSMSTSPQASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSLSLAGSRLS
SGFQSSTLLTSVRLQFLAGCFGLGTVGHTVGAKGESGRLHHYQDGIRAAKRSIQIEIQVA
VHKIYQQLSATLERALQANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQ
LCGTDTMLGQPLQLLPKSGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDL
LCSQLKNLLSQTGVLLMALFGEGEKEEGEEEKKKVDSSGEIEKKDFRAALRKQHAAELHL
GDFLVFLRRVVSSKAIQSKMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAV
LPACESGVEDDQMAQVVECLFSLLSDCMWDTPIAQAKHAIQIKEKEQEIKSQKQGELEEE
DENLPIQEVSFDPEKAQCCLVENGQVLTHGSGGKGYGLASTGITSGCYQWKFYIVKENRG
NEGTCVGVSRWPVHDFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDME
ARTISFGKNGEEPKLAFEDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPI
CSPVAAVLAEATTQLIRILHRTDRWTYSINKKMMERLHKIKMCIKESGQKLKKSRSIQSR
EENEMREEKENKDEEKGKHTRHGLADLSEPQLRTLCTEVWPVLAVIGGVDAGLRVGGRCV
HKQTGRHATLLGVVKEGSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVAR
FRGLTASVLLDLTYLTGIHEDMGKQSAKRHEKKHRHESEEKDSEQRPETEASVDVRTGLS
DDAKGQGATSSKSENEIASFSLDPALPSVESQHQITEGKRKNHEHVSRNHDIAQSEIRAV
QLSYLYLGAMKSLSALLGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFL
MRHMVKRAVMRSPIKRVLGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEVDQQAEESDQ
AQQAQTPVTTSPSASSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFS
SYPTTTVLPTRRAQTPPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLST
SPPPPAIAVPLLEMGFSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEDPQP
SSTVDSRRGTAVLGSSGKSNDPCYLQSPGDIPSADAAEMEEGFTESPDNLDHTENAASGS
GPPARGRSAVTRRHKFDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNL
DEELEIDLDDEAMEAMFGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCEC
SVISFNQHMKRNHPGCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLAL
KTKSKTTSSERYKGQAPDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDR
RIVPEPVQFPDSDPLGASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALTN
PHDRIVALKRVTAAAQVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMC
LAAAGRAGLSTSPSATTSSSERSRGGHSKANKPISCLAYLSTAVGCLASNTPSAAKLLVQ
LCTQNLISAATGVNLTTVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKG
AKLRPNYDKSEVEKKGPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTAP
QTLADMGGDLRKCSFIKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQ
TCVFNRLEGDAEDSLGSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPH
WVSALAWPEEGPAAAWSGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVT
CIAWFSEDRQFAVGYFDGKLLLGTKEPLEKGGIVLIDAHKETLVSMKWDPTGHILMTCAK
EENVKLWGPISGCWCCLHSLCHPSIVNGIAWCSLPGKGSKLQLLMATGCQNGLVCVWHIP
QDTTQTSVTSSEGWWDQDSNCQDGYRKSTGARCVYQLRGHITPVRTVTFSSDGLALVSGG
LGGLMNIWSLRDGSVLQTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWAAAN
HVLATCRTALKQQGVLGLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQC
LASLAVGLHLDQLLCSPPVPPHHQNCLPDPASWNPNEWAWLGCFSTTIKAAEALTNGAQF
PESFTVPDLEPVPEDELVLLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGR
HGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDD
LHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPR
QIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNRKLPERVTALEGY
QIGQVACGLNHTLAVSTDGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVAC
GTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPILAGVVIEDVAVGAEHTLAL
ASTGDVYAWGSNSEGQLGLGHTNHVREPTLVTVLQGKNIRQISAGRCHSAAWTAPPVPPR
APGVSVPLQLGLPDMVPPQYGTLREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQS
STSHYNAGTWGIVQGQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKC
KPIFVQIARQVVKLNASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDL
LIPSPNATAEVGYNRDRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPLVWK
QLCCIPLTLEDLEEVDLLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPI
IPGGNSIPLTFSNRKEYVERAIEYRLHEMDRQQVAAVREGMSWIVPVPLLSLLTSKQLEQ
MVCGMPEISVEVLKKVVRYREVDEQHQLVQWFWRTLEEFSNEERVLFMRFVSGRSRLPAN
TADISQRFQIMKVDRPYDSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNY
MLSRNVDNAEGSDTDY
Download sequence
Identical sequences 10141.ENSCPOP00000005319 ENSCPOP00000005319 ENSCPOP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]