SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000005637 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10141.ENSCPOP00000005637
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily Elafin-like 0.000109
Family Elafin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000005637
Sequence length 60
Comment (Cavia porcellus)
Sequence
ETRLVPKIKICEKTPEFYQCNRQCEAHRDCQANNICCSAFCGNICMSLLQVEAWTMLPAP
Download sequence
Identical sequences 10141.ENSCPOP00000005637 ENSCPOP00000005637 ENSCPOP00000005637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]