SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006634 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006634
Domain Number 1 Region: 272-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-33
Family Pentraxin (pentaxin) 0.00062
Further Details:      
 
Weak hits

Sequence:  10141.ENSCPOP00000006634
Domain Number - Region: 100-183
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.00275
Family ESAT-6 like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006634
Sequence length 481
Comment (Cavia porcellus)
Sequence
MDHPGRRTLLFFLAFVPIYLHGASSQEGKLVQQRKPFFERLRRLEEQFQRFQEVTLTHLQ
GIANNYNVSYNIDTQFQRLTEESQALVLTINRSQAAVQEDLAHLKTWMKKTKRRGRKVDT
RLQALDLALSEKSKHQAWEGKNQKAQQDAISRLALNVSTLQNTLAHLEHQVNRQSTRLAA
LEGQLQMANSDTAAQGLILAPNQPMQPGLNSPKLYHEKQALRHRNSPQDLTATLQGTQKP
PSSSNHWTSTAAPRGPPQLAWPPQGTGKICNIGPVFVFPNASAENVVFLSPGFLKGLRAL
SFCTWIRMTSGYLGTLFSYATEDNDNKLVLHGRDSLVPGSMHFVIGDPAFRELPLQLLLD
SQWHHICVSWTSTQGRYWLYVDRRLVAAGSHFREDYEIPPGGSLVLGQDQDNVGGGFDSA
EAFVGSMSGLALWDRTLFPREVANLAIGKEIPTGAILTLANVTLVRGFVQRINCPCLEHC
P
Download sequence
Identical sequences ENSCPOP00000006634 ENSCPOP00000006634 XP_003478147.1.53824 10141.ENSCPOP00000006634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]