SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006635
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 3.27e-56
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 230-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-27
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006635
Sequence length 519
Comment (Cavia porcellus)
Sequence
MAPHITFFWIVLILLLQNSVLAEDGEIRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
ANITSNFDIGPKFIQVGVVQYSDYPVLEIPLGSYDSGRHLMEAMQSVLYLGGNTRTGKAI
QFALDYLFAKSSRFLTKIAVVLTDGKSQDEVKDAAEAARDNGITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVMKQKLCEESVCPTRIPVAARDEKGFDILLGLGVK
KKAKKRIQLSPTKIKGYEITSKVDLSEVTSNIFPEGLPPSYVFVSTQRFKVKKVWDLWRI
LTIHGKPQIAVTLNGVDKTLSFTTTSVINGSQVAVFAGPQVKTLFDEEWHQIRLLVTEQD
VTLFIDDQEIDSKPLHLTLGIFVSGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFNGECLNGPSDVGSTPAPCVCPPGKPGPQGPKGDPGLPGNPGHPGQTGQDVGLSG
NLRITRCSRIPRNTRSTWTTRLQRRTRERWPKGKYAQLR
Download sequence
Identical sequences ENSCPOP00000006635 10141.ENSCPOP00000006635 ENSCPOP00000006635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]