SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000006996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000006996
Domain Number 1 Region: 34-128
Classification Level Classification E-value
Superfamily POZ domain 6.28e-28
Family Tetramerization domain of potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000006996
Sequence length 154
Comment (Cavia porcellus)
Sequence
MALADSTRGLPNGGGGGGGSGSSSSSAEPALFPDIVELNVGGQVYVTRRCTVVSVPDSLL
WRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYF
ELPELVRRLGAPQQPGPGPPHSRRGVHKEGSLGD
Download sequence
Identical sequences 10141.ENSCPOP00000006996 ENSCPOP00000006996 ENSCPOP00000006996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]